DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4666 and THEM6

DIOPT Version :9

Sequence 1:NP_001284923.1 Gene:CG4666 / 31541 FlyBaseID:FBgn0029838 Length:193 Species:Drosophila melanogaster
Sequence 2:NP_057731.1 Gene:THEM6 / 51337 HGNCID:29656 Length:208 Species:Homo sapiens


Alignment Length:203 Identity:76/203 - (37%)
Similarity:108/203 - (53%) Gaps:23/203 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LVVLLIL----YVIWDVNYFIRCVFTVFAGRLFQ-RKRKVTDTTTIYGLCTSQDVDIFIRHMNNA 63
            ||.||.|    :.:.||.|.:|....|...||.| |.|.:.......|.....|:|:.: |||||
Human     5 LVALLALGLAVFALLDVWYLVRLPCAVLRARLLQPRVRDLLAEQRFPGRVLPSDLDLLL-HMNNA 68

  Fly    64 RYLRELDFARFHFYALTGLYERIRDRRGGAVQGASSVRYRRTIPIFHPYKIQTKLIWWDDKAIYL 128
            |||||.||||.......|:...:|:.|...|..||..|:||::.:..|::::|:|:.|||:|.||
Human    69 RYLREADFARVAHLTRCGVLGALRELRAHTVLAASCARHRRSLRLLEPFEVRTRLLGWDDRAFYL 133

  Fly   129 EQQFITLSDGFVRAVAMSKQNITNCNVLEVLKTYPE-----TAQR----PEKPEELKLWLDAIEL 184
            |.:|::|.||||.|:...:|::        |.|.||     ..||    ||.|.:|:.|:...|.
Human   134 EARFVSLRDGFVCALLRFRQHL--------LGTSPERVVQHLCQRRVEPPELPADLQHWISYNEA 190

  Fly   185 SSQKLRKD 192
            |||.||.:
Human   191 SSQLLRME 198

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4666NP_001284923.1 4HBT_2 48..179 CDD:404206 53/139 (38%)
THEM6NP_057731.1 4HBT_2 54..185 CDD:315859 53/139 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165147849
Domainoid 1 1.000 92 1.000 Domainoid score I7612
eggNOG 1 0.900 - - E1_KOG4366
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H105296
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG59462
OrthoDB 1 1.010 - - D1195870at2759
OrthoFinder 1 1.000 - - FOG0003421
OrthoInspector 1 1.000 - - otm40591
orthoMCL 1 0.900 - - OOG6_106004
Panther 1 1.100 - - O PTHR12475
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4781
SonicParanoid 1 1.000 - - X2773
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1514.750

Return to query results.
Submit another query.