Sequence 1: | NP_001284923.1 | Gene: | CG4666 / 31541 | FlyBaseID: | FBgn0029838 | Length: | 193 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_572293.1 | Gene: | CG4660 / 31542 | FlyBaseID: | FBgn0029839 | Length: | 261 | Species: | Drosophila melanogaster |
Alignment Length: | 250 | Identity: | 74/250 - (29%) |
---|---|---|---|
Similarity: | 123/250 - (49%) | Gaps: | 60/250 - (24%) |
- Green bases have known domain annotations that are detailed below.
Fly 1 MSWLVVLLILYVIWDVNYFIRCVFTVFAGRLFQRKRKVTDTTTIYGLCTSQDVDIFIRHMNNARY 65
Fly 66 LRELDFARFHFYALTGLYERIRDRRGGAVQGASSVRYRRTIPIFHPYKIQTKLIWWDDKAIYLEQ 130
Fly 131 QFITLSDGFVRAVAMSKQNITNCNVLEVL-KTYPETAQ--------------------------- 167
Fly 168 --------------------------------RPEKPEELKLWLDAIELSSQKLR 190 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG4666 | NP_001284923.1 | 4HBT_2 | 48..179 | CDD:404206 | 54/190 (28%) |
CG4660 | NP_572293.1 | 4HBT_2 | 56..162 | CDD:290018 | 47/105 (45%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C45450021 | |
Domainoid | 1 | 1.000 | 97 | 1.000 | Domainoid score | I7172 |
eggNOG | 1 | 0.900 | - | - | E1_KOG4366 | |
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 1 | 1.050 | 117 | 1.000 | Inparanoid score | I4796 |
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D105164at6960 | |
OrthoFinder | 1 | 1.000 | - | - | FOG0003421 | |
OrthoInspector | 1 | 1.000 | - | - | mtm6532 | |
orthoMCL | 1 | 0.900 | - | - | OOG6_106004 | |
Panther | 1 | 1.100 | - | - | P | PTHR12475 |
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 1 | 1.030 | - | avgDist | Average_Evolutionary_Distance | R4781 |
SonicParanoid | 1 | 1.000 | - | - | X2773 | |
12 | 11.830 |