DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4666 and CG4660

DIOPT Version :9

Sequence 1:NP_001284923.1 Gene:CG4666 / 31541 FlyBaseID:FBgn0029838 Length:193 Species:Drosophila melanogaster
Sequence 2:NP_572293.1 Gene:CG4660 / 31542 FlyBaseID:FBgn0029839 Length:261 Species:Drosophila melanogaster


Alignment Length:250 Identity:74/250 - (29%)
Similarity:123/250 - (49%) Gaps:60/250 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSWLVVLLILYVIWDVNYFIRCVFTVFAGRLFQRKRKVTDTTTIYGLCTSQDVDIFIRHMNNARY 65
            :|.|:.::::|.:.:::||:|....|...|..:|:..:.||||:.|||.:.|||..:.|||||||
  Fly     9 LSVLLAIIVVYGLLELHYFLRMCLCVLLARFVKRRCHILDTTTVNGLCLTNDVDTLLYHMNNARY 73

  Fly    66 LRELDFARFHFYALTGLYERIRDRRGGAVQGASSVRYRRTIPIFHPYKIQTKLIWWDDKAIYLEQ 130
            .|||||||..||..|.||..|....|...|||:::||||.|..||.:.|.:::|:||::::::|.
  Fly    74 FRELDFARVDFYERTNLYRTITGMGGSVFQGAATIRYRRFIRPFHRFNIISRIIYWDEQSLFMEH 138

  Fly   131 QFITLSDGFVRAVAMSKQNITNCNVLEVL-KTYPETAQ--------------------------- 167
            :|:..||.||..:|:.:|.:.:.::..|: :..|.|:.                           
  Fly   139 RFVRPSDKFVHCIAICRQRVIDVSMEAVMSELLPRTSSNGFRATVLTSLAAPSPAAGGISNPAMD 203

  Fly   168 --------------------------------RPEKPEELKLWLDAIELSSQKLR 190
                                            :|..|.||..|::..::||:.||
  Fly   204 TSLAENGHGTTSGGAAGTGATASATAAHCLKLKPSLPPELAKWIEYNDMSSKNLR 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4666NP_001284923.1 4HBT_2 48..179 CDD:404206 54/190 (28%)
CG4660NP_572293.1 4HBT_2 56..162 CDD:290018 47/105 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45450021
Domainoid 1 1.000 97 1.000 Domainoid score I7172
eggNOG 1 0.900 - - E1_KOG4366
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 117 1.000 Inparanoid score I4796
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D105164at6960
OrthoFinder 1 1.000 - - FOG0003421
OrthoInspector 1 1.000 - - mtm6532
orthoMCL 1 0.900 - - OOG6_106004
Panther 1 1.100 - - P PTHR12475
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4781
SonicParanoid 1 1.000 - - X2773
1211.830

Return to query results.
Submit another query.