DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4666 and them6

DIOPT Version :9

Sequence 1:NP_001284923.1 Gene:CG4666 / 31541 FlyBaseID:FBgn0029838 Length:193 Species:Drosophila melanogaster
Sequence 2:NP_001119977.1 Gene:them6 / 100144931 XenbaseID:XB-GENE-6455857 Length:206 Species:Xenopus tropicalis


Alignment Length:197 Identity:72/197 - (36%)
Similarity:118/197 - (59%) Gaps:6/197 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSWLVVL--LI--LYVIWDVNYFIRCVFTVFAGRLFQRKRKVTDTTTIYGLCTSQDVDIFIRHMN 61
            |.:||:|  ||  ::.:.||.||:|....|...|:....:.:.......|:....|:| |:.|||
 Frog     1 MLFLVLLSGLIAAIFSLLDVWYFVRGALVVLKARIQPVVKDLLKEHCYGGIVLPHDLD-FLFHMN 64

  Fly    62 NARYLRELDFARFHFYALTGLYERIRDRRGGAVQGASSVRYRRTIPIFHPYKIQTKLIWWDDKAI 126
            |:|||||.|||||..:..:||::.:|....|.|...|::||||::.:...::|:|:|:.|||||.
 Frog    65 NSRYLREADFARFAHFTRSGLFQAVRYLGAGMVMAGSTIRYRRSLRLLETFEIRTRLLCWDDKAF 129

  Fly   127 YLEQQFITLSDGFVRAVAMSKQNITNCNVLEVLKTY-PETAQRPEKPEELKLWLDAIELSSQKLR 190
            |:||:|:...|.||.||.:|:|::...:..:|:::. ....:.||.|||:..|:...:.|||:||
 Frog   130 YVEQRFVAPKDDFVCAVLLSRQHVIGNSPDKVVQSMCKRKVESPEYPEEVAHWIKYNDASSQQLR 194

  Fly   191 KD 192
            .:
 Frog   195 AE 196

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4666NP_001284923.1 4HBT_2 48..179 CDD:404206 52/131 (40%)
them6NP_001119977.1 4HBT_2 52..183 CDD:290018 52/131 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 101 1.000 Domainoid score I6842
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H105296
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG59462
OrthoDB 1 1.010 - - D1195870at2759
OrthoFinder 1 1.000 - - FOG0003421
OrthoInspector 1 1.000 - - mtm9405
Panther 1 1.100 - - O PTHR12475
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4781
SonicParanoid 1 1.000 - - X2773
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1111.060

Return to query results.
Submit another query.