DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4666 and si:ch73-52e5.2

DIOPT Version :9

Sequence 1:NP_001284923.1 Gene:CG4666 / 31541 FlyBaseID:FBgn0029838 Length:193 Species:Drosophila melanogaster
Sequence 2:XP_017212901.1 Gene:si:ch73-52e5.2 / 100142654 ZFINID:ZDB-GENE-070912-341 Length:207 Species:Danio rerio


Alignment Length:188 Identity:70/188 - (37%)
Similarity:110/188 - (58%) Gaps:6/188 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LILYVIWDVNYFIRCVFTVFAGRLFQRKRKVTDTTTIYGLCTSQDVDIFIRHMNNARYLRELDFA 72
            |:|:..:||.||:|.::...........|.|.....::|.....|:| |:.||||||||||.|||
Zfish    15 LLLFGTFDVWYFLRGLWVALRCCFQSPIRDVLAEQVVHGRVLLHDMD-FMCHMNNARYLRECDFA 78

  Fly    73 RFHFYALTGLYERIRDRRGGAVQGASSVRYRRTIPIFHPYKIQTKLIWWDDKAIYLEQQFITLSD 137
            ||......||:...|..:...|.||:::||||::.:...::::|:::.||:|:.||||:|::.||
Zfish    79 RFAHGTRIGLFMAARALKATMVVGATTIRYRRSLALGEGFELRTRIVSWDEKSFYLEQRFVSKSD 143

  Fly   138 GFVRAVAMSKQNI---TNCNVLEVLKTYPETAQRPEKPEELKLWLDAIELSSQKLRKD 192
            ||:.||.:.:||:   :..|:||.|  .......|:..|||:.|:..|..|||.||.:
Zfish   144 GFISAVMLCRQNVIRGSPQNILEFL--CKRKVDCPDISEELQHWIRFISASSQALRAE 199

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4666NP_001284923.1 4HBT_2 48..179 CDD:404206 53/133 (40%)
si:ch73-52e5.2XP_017212901.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170581721
Domainoid 1 1.000 97 1.000 Domainoid score I7172
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H105296
Inparanoid 1 1.050 129 1.000 Inparanoid score I4632
OMA 1 1.010 - - QHG59462
OrthoDB 1 1.010 - - D1195870at2759
OrthoFinder 1 1.000 - - FOG0003421
OrthoInspector 1 1.000 - - mtm6532
orthoMCL 1 0.900 - - OOG6_106004
Panther 1 1.100 - - O PTHR12475
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4781
SonicParanoid 1 1.000 - - X2773
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
1414.030

Return to query results.
Submit another query.