DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp5D and TSPAN18

DIOPT Version :9

Sequence 1:NP_001259266.1 Gene:Tsp5D / 31540 FlyBaseID:FBgn0029837 Length:287 Species:Drosophila melanogaster
Sequence 2:XP_005253274.1 Gene:TSPAN18 / 90139 HGNCID:20660 Length:258 Species:Homo sapiens


Alignment Length:263 Identity:73/263 - (27%)
Similarity:132/263 - (50%) Gaps:41/263 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 TCIRRTFCWLNIILWLCSCAFLGAGLWLRLSYAGYATLLPQH-AGLSADTIFMGIGGTGFVVSFF 70
            :|::......|..::|.....|..|:|:.:...|:..::..: ..|:...|.:.:||..|::.|.
Human    17 SCMKYLMFVFNFFIFLGGACLLAIGIWVMVDPTGFREIVAANPLLLTGAYILLAMGGLLFLLGFL 81

  Fly    71 GCCGAWVQSRCLLVLYFMLIVMLFMSEFLVGSIAFLFRGGLGRTLANELRFGIERHYNSSDRGSL 135
            |||||..:::|||:.:|:.|:::|::|.....:||:||..|.|....:   .:.:||    :|:.
Human    82 GCCGAVRENKCLLLFFFLFILIIFLAELSAAILAFIFRENLTREFFTK---ELTKHY----QGNN 139

  Fly   136 VAPSVASIWDSVQQSFECCGVSSYEDW----------YDIQSWPGRRWVPESCCRTLYDQRQVLT 190
            .....::.|:||..:|.||||:..||:          .|.:.      |||:|||.....|    
Human   140 DTDVFSATWNSVMITFGCCGVNGPEDFKFASVFRLLTLDSEE------VPEACCRREPQSR---- 194

  Fly   191 EGSGDGMM--RPDC--GRSENPSLWWDK-GCAHSLQSWFTGQLNVVGAVGLGIAFVQLFGLITSM 250
                ||::  |.:|  ||    ||:.:| ||...:.:.|...:.:.||:.:|:..::||.:|.:|
Human   195 ----DGVLLSREECLLGR----SLFLNKQGCYTVILNTFETYVYLAGALAIGVLAIELFAMIFAM 251

  Fly   251 LLF 253
            .||
Human   252 CLF 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp5DNP_001259266.1 Tetraspannin 8..256 CDD:278750 73/262 (28%)
NET-5_like_LEL 105..228 CDD:239418 38/137 (28%)
TSPAN18XP_005253274.1 Tetraspannin 20..253 CDD:395265 70/257 (27%)
uroplakin_I_like_LEL 115..228 CDD:239409 39/137 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X124
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.