DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp5D and TSPAN4

DIOPT Version :9

Sequence 1:NP_001259266.1 Gene:Tsp5D / 31540 FlyBaseID:FBgn0029837 Length:287 Species:Drosophila melanogaster
Sequence 2:XP_011518638.1 Gene:TSPAN4 / 7106 HGNCID:11859 Length:269 Species:Homo sapiens


Alignment Length:249 Identity:72/249 - (28%)
Similarity:116/249 - (46%) Gaps:32/249 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 LW---LCSCAFLGAGLWLRLSYAGYATLLPQHAGLSADTIFMGIGGTGFVVSFFGCCGAWVQSRC 81
            ||   |..|..||.|:||..:...:|||......|||..:.:..|.....:.|.||.||..:::|
Human    48 LWPAQLGGCGVLGVGIWLAATQGSFATLSSSFPSLSAANLLIITGAFVMAIGFVGCLGAIKENKC 112

  Fly    82 LLVLYFMLIVMLFMSEFLVGSIAFLFRGGLGRTLANELRFGIERHYNSSDRGSLVAPSVASIWDS 146
            ||:.:|:|::::|:.|..:..:.|.:...:.|....:|:.|:..:....:.|      :.:.|..
Human   113 LLLTFFLLLLLVFLLEATIAILFFAYTDKIDRYAQQDLKKGLHLYGTQGNVG------LTNAWSI 171

  Fly   147 VQQSFECCGVSSYEDWYDIQSWPGRRWVPESCCRTLYDQRQVLTEGSGDGMMRPDCGRSENPSLW 211
            :|..|.|||||:|.||:::.:   ...||:|||....:                .|| ...|..|
Human   172 IQTDFRCCGVSNYTDWFEVYN---ATRVPDSCCLEFSE----------------SCG-LHAPGTW 216

  Fly   212 WDKGCAHSLQSWFTGQLNVVGAVGLGIAFVQLFGLITSMLLFCTVKHKRASDTY 265
            |...|..:::.|....|..||..||..|.||:.||..:|.::|.|.   .:|||
Human   217 WKAPCYETVKVWLQENLLAVGIFGLCTALVQILGLTFAMTMYCQVV---KADTY 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp5DNP_001259266.1 Tetraspannin 8..256 CDD:278750 68/238 (29%)
NET-5_like_LEL 105..228 CDD:239418 28/122 (23%)
TSPAN4XP_011518638.1 Tetraspannin 63..261 CDD:278750 61/223 (27%)
NET-5_like_LEL 136..233 CDD:239418 28/122 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 141 1.000 Domainoid score I4711
eggNOG 1 0.900 - - E1_KOG3882
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 143 1.000 Inparanoid score I4462
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG45282
OrthoDB 1 1.010 - - D1224210at2759
OrthoFinder 1 1.000 - - FOG0001172
OrthoInspector 1 1.000 - - otm41382
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X124
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
1110.880

Return to query results.
Submit another query.