DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp5D and Tsp42Ea

DIOPT Version :9

Sequence 1:NP_001259266.1 Gene:Tsp5D / 31540 FlyBaseID:FBgn0029837 Length:287 Species:Drosophila melanogaster
Sequence 2:NP_525012.2 Gene:Tsp42Ea / 59178 FlyBaseID:FBgn0029508 Length:226 Species:Drosophila melanogaster


Alignment Length:212 Identity:46/212 - (21%)
Similarity:92/212 - (43%) Gaps:50/212 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 IGGTGFVVSFFGCCGAWVQSRCLLVLYFMLIVMLFMSEFLVGSIAFLFRGGLGRTLANELRFG-- 122
            :|....::|:||||||..:|.|:.:.|.:|:.:|     ::|.:|.:....:.:....|: .|  
  Fly    59 LGTIILLISWFGCCGAIRESYCMSMTYSILLFVL-----MIGQLALVIYMWVQKDKYLEI-MGDV 117

  Fly   123 IERHYNSSDRGSLVAPSVASIWDSVQQSFECCGVSSYEDWYDIQSWPGRRWVPESCCRTLYDQRQ 187
            :|:.:|.       ..|.:...|::|.|.:|||.|.|.|:    ::.|:  .|.|||        
  Fly   118 VEKAWNH-------RTSRSDYMDAIQISMKCCGRSGYTDY----AYQGK--FPPSCC-------- 161

  Fly   188 VLTEGSGDGMMRPDCGRSENPSLWWD----KGCAHSLQSWFTGQLNVVGAVGLGIAFVQLFGLIT 248
                             |:..:..|:    :||..:...::....:::...||.||.::..|.:.
  Fly   162 -----------------SDTNNCRWETVYRRGCKVTFVEFWDRNSDIIKYAGLVIAAIEFVGFVF 209

  Fly   249 SMLLFCTVKHKRASDTY 265
            :..|..::::.|....|
  Fly   210 ACCLANSIRNYRRRAEY 226

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp5DNP_001259266.1 Tetraspannin 8..256 CDD:278750 44/201 (22%)
NET-5_like_LEL 105..228 CDD:239418 23/128 (18%)
Tsp42EaNP_525012.2 Tetraspannin 8..217 CDD:278750 44/201 (22%)
tetraspanin_LEL 104..188 CDD:239401 23/122 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR19282
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.