DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp5D and tspan37

DIOPT Version :9

Sequence 1:NP_001259266.1 Gene:Tsp5D / 31540 FlyBaseID:FBgn0029837 Length:287 Species:Drosophila melanogaster
Sequence 2:NP_001292501.1 Gene:tspan37 / 564334 ZFINID:ZDB-GENE-070912-550 Length:245 Species:Danio rerio


Alignment Length:195 Identity:46/195 - (23%)
Similarity:84/195 - (43%) Gaps:34/195 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    61 GGTGFVVSFFGCCGAWVQSRC--LLVLYFMLIVMLFMSEFLVGSIAFLFRGGLGRTLANELRFGI 123
            |...|:....||..:..:..|  .|.:||::||...:.  ...::|:.::|.|...|| .|:...
Zfish    59 GAILFITGSIGCLVSSKKPSCGHGLFVYFLIIVFCVVG--TTAALAYFYQGKLDAELA-PLKDVF 120

  Fly   124 ERHYNSSDRGSLVAPSVASIWDSVQQSFECCGVSSYEDWYDIQS-W---PGRRWVPESCCRTLYD 184
            :.:.|:|.     .|...:: |.:|...:||||.:|.||  :|: |   .|:..||:|||.|.:.
Zfish   121 QNYSNNSQ-----DPDTKAV-DRLQSELQCCGVMNYTDW--LQTPWFNHSGKYDVPQSCCNTTFH 177

  Fly   185 QRQVLTEGSGDGMMRPDC-GRSENPSLWWDKGCAHSLQSWFTGQLNVVGAVGLGIAFVQLFGLIT 248
                            .| |..:.|.|.:::.|...|:......::::....|.:..:.:...||
Zfish   178 ----------------SCNGTLDAPMLLYNEACQVKLKELLLLVVHIIHITSLVVLVLLVLSWIT 226

  Fly   249  248
            Zfish   227  226

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp5DNP_001259266.1 Tetraspannin 8..256 CDD:278750 46/195 (24%)
NET-5_like_LEL 105..228 CDD:239418 32/127 (25%)
tspan37NP_001292501.1 Tetraspannin 14..194 CDD:278750 41/161 (25%)
TM4SF8_like_LEL 102..195 CDD:239416 31/117 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
32.770

Return to query results.
Submit another query.