DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp5D and tspan1

DIOPT Version :9

Sequence 1:NP_001259266.1 Gene:Tsp5D / 31540 FlyBaseID:FBgn0029837 Length:287 Species:Drosophila melanogaster
Sequence 2:NP_001016107.1 Gene:tspan1 / 548861 XenbaseID:XB-GENE-868363 Length:245 Species:Xenopus tropicalis


Alignment Length:257 Identity:62/257 - (24%)
Similarity:112/257 - (43%) Gaps:30/257 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 YTCIRRTFCWLNIILWLCSCAFLGAGLWLRLSYAGYATLLPQHAGLSA------DTIFMGIGGTG 64
            :|.|:......|:.::|.....||.|:|:.:....:..:....:..:|      ....:.||...
 Frog     4 FTFIKVMMILFNVFIFLGGGTLLGVGIWVSVDSNSFLKIFGTVSASAALQFVNVGYFLIAIGSLL 68

  Fly    65 FVVSFFGCCGAWVQSRCLLVLYFMLIVMLFMSEFLVGSIAFLFRGGLGRTLANE-LRFGIERHYN 128
            .::.|.|||||..:|:|||:.:|.:|:::|::| :.|::..|....|..|:... |:..::..|.
 Frog    69 VILGFLGCCGAQRESKCLLLTFFSIILIIFIAE-VAGAVVALVYSSLAETILGPLLKPVLQNEYG 132

  Fly   129 SSDRGSLVAPSVASIWDSVQQSFECCGVSSYEDWYDIQSW-PGRRWVPESCCRTLYDQRQVLTEG 192
            |:       |.|..||:|..::..|||.::|.|:.:...: ...:..|..||.:......|.|: 
 Frog   133 SN-------PDVTKIWNSTMENLHCCGFNNYTDFSNSTFYNNNHQQYPSYCCNSTSSANSVCTQ- 189

  Fly   193 SGDGMMRPDCGRSENPSLWWDKGCAHSLQSWFTGQLNVVGAVGLGIAFVQLFGLITSMLLFC 254
              .|.|....           .||...|.........:||.|..||..::|..::.||.|:|
 Frog   190 --QGAMNSHV-----------SGCFSQLIYLIRQNAAIVGGVAAGICALELAAMVVSMYLYC 238

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp5DNP_001259266.1 Tetraspannin 8..256 CDD:278750 61/255 (24%)
NET-5_like_LEL 105..228 CDD:239418 26/124 (21%)
tspan1NP_001016107.1 Tetraspannin 7..236 CDD:366035 59/250 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X124
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.