DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp5D and TSPAN11

DIOPT Version :9

Sequence 1:NP_001259266.1 Gene:Tsp5D / 31540 FlyBaseID:FBgn0029837 Length:287 Species:Drosophila melanogaster
Sequence 2:XP_011518981.1 Gene:TSPAN11 / 441631 HGNCID:30795 Length:302 Species:Homo sapiens


Alignment Length:239 Identity:67/239 - (28%)
Similarity:118/239 - (49%) Gaps:39/239 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 NIILWLCSCAFLGAGLWLRLSYAGYATLLPQHAGLSADTIFMGIGGTGFVVSFFGCCGA--WVQS 79
            |...|:...|.|..|:|..:..:||.::|......::..|.:..|....|..|.| .||  |.:.
Human    24 NFFFWVGGAAVLAVGIWTLVEKSGYLSVLASSTFAASAYILIFAGVLVMVTGFLG-FGAILWERK 87

  Fly    80 RCLLVLYFMLIVMLFMSEFLVGSIAFLFRGGLGRTLANELRFGIERHYN---SSDRGSLVAPSVA 141
            .||.. ||.|::::|:.|.:.|.:|.::.    :.|::||:    :|.|   :.:.|...|..:.
Human    88 GCLST-YFCLLLVIFLVELVAGVLAHVYY----QRLSDELK----QHLNRTLAENYGQPGATQIT 143

  Fly   142 SIWDSVQQSFECCGVSSYEDWYD-----IQSWPGRRWVPESCCRTLYDQRQVLTEGSGDGMMRPD 201
            :..|.:||.|:|||.:|..||..     ::...||: ||:|||:|:              ::|  
Human   144 ASVDRLQQDFKCCGSNSSADWQHSTYILLREAEGRQ-VPDSCCKTV--------------VVR-- 191

  Fly   202 CGRSENPSLWW--DKGCAHSLQSWFTGQLNVVGAVGLGIAFVQL 243
            ||:..:||..:  :.||...|:.:....|.::||||:|:|.:|:
Human   192 CGQRAHPSNIYKVEGGCLTKLEQFLADHLLLMGAVGIGVACLQI 235

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp5DNP_001259266.1 Tetraspannin 8..256 CDD:278750 67/239 (28%)
NET-5_like_LEL 105..228 CDD:239418 33/132 (25%)
TSPAN11XP_011518981.1 Tetraspannin 16..235 CDD:278750 66/237 (28%)
PHA03242 <50..>118 CDD:177566 18/73 (25%)
CD151_like_LEL 112..220 CDD:239408 33/132 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X124
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.