DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp5D and tspan18b

DIOPT Version :9

Sequence 1:NP_001259266.1 Gene:Tsp5D / 31540 FlyBaseID:FBgn0029837 Length:287 Species:Drosophila melanogaster
Sequence 2:XP_005159229.1 Gene:tspan18b / 436712 ZFINID:ZDB-GENE-040718-137 Length:258 Species:Danio rerio


Alignment Length:261 Identity:73/261 - (27%)
Similarity:133/261 - (50%) Gaps:39/261 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 TCIRRTFCWLNIILWLCSCAFLGAGLWLRLSYAGYATLLPQHAGLSADT-IFMGIGGTGFVVSFF 70
            :||:......|.:::|.....||.|:|:.:...|:..::..:..|.... |.:.:||..|::.|.
Zfish    19 SCIKYLMFVFNFLIFLGGSFLLGVGVWVVVDPTGFREIVAANPLLFTGVYIILAMGGMLFLLGFL 83

  Fly    71 GCCGAWVQSRCLLVLYFMLIVMLFMSEFLVGSIAFLFRGGLGRT-LANELRFGIERH---YNSSD 131
            |||||..:::|||:.:||||:::|::|.....:||:||..|.|. ...||:    :|   ||::|
Zfish    84 GCCGAIRENKCLLLFFFMLILIIFLAELAAAILAFIFREHLTREYFTKELK----KHYQGYNNTD 144

  Fly   132 RGSLVAPSVASIWDSVQQSFECCGVSSYEDWYD--IQSWPGRRWVPESCCR-------TLYDQRQ 187
                   ...|.|:::..:|:||||:|.||:.:  .:.......|||:|||       :.:..|:
Zfish   145 -------VFTSTWNAIMNTFDCCGVNSPEDFEESIFRIINPSEMVPEACCRRNNHVGESGFSNRE 202

  Fly   188 VLTEGSGDGMMRPDCGRSENPSLWWDKGCAHSLQSWFTGQLNVVGAVGLGIAFVQLFGLITSMLL 252
            ....||   |:..:           :|||..::..:|...:.|.||:.:.:..::||.::.:|.|
Zfish   203 ECLSGS---MLYRN-----------NKGCYSAVVDYFEMYIYVAGALAIVVLTIELFAMVFAMCL 253

  Fly   253 F 253
            |
Zfish   254 F 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp5DNP_001259266.1 Tetraspannin 8..256 CDD:278750 73/260 (28%)
NET-5_like_LEL 105..228 CDD:239418 35/135 (26%)
tspan18bXP_005159229.1 Tetraspannin 20..257 CDD:278750 73/260 (28%)
uroplakin_I_like_LEL 118..229 CDD:239409 35/135 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X124
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.