DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp5D and Tsp96F

DIOPT Version :9

Sequence 1:NP_001259266.1 Gene:Tsp5D / 31540 FlyBaseID:FBgn0029837 Length:287 Species:Drosophila melanogaster
Sequence 2:NP_001262976.1 Gene:Tsp96F / 43127 FlyBaseID:FBgn0027865 Length:284 Species:Drosophila melanogaster


Alignment Length:313 Identity:72/313 - (23%)
Similarity:130/313 - (41%) Gaps:69/313 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MG-NAGYTCIRRTFCWLNIILWLCSCAFLGAGLWLRLSYAGYATLLPQ-----HAGLSADTIFMG 59
            || |...:|::.....:||:.||.....:...:|: |:...:...:.|     |..|   .:|:.
  Fly     1 MGLNGCCSCVKYLMVLINILFWLIGLTIVVTSVWM-LTDPTFMLSMTQNYNHYHIAL---YVFLA 61

  Fly    60 IGGTGFVVSFFGCCGAWVQSRCLLVLYFMLIVMLFMSEFLVGSIAFLFRGGLGRTLANELRFGIE 124
            ||....:.:||||||...:|:||||.:|.:|:::.:::...|:.||..:..|...:...::..::
  Fly    62 IGILITLGAFFGCCGVCRESQCLLVSFFCVILIVMVAQIAAGAWAFHNKDKLDDIVRAAVKSSVQ 126

  Fly   125 RHYNSSDRGSLVAPSVASIWDSVQQSFECCGVSSYEDW------------------------YDI 165
            ..|..|...|...     .:|::|::.:|||.....||                        |:|
  Fly   127 EEYGQSTMSSRTV-----TFDTLQKNLKCCGADGPGDWATSRFNNVDRTNIVEIAVSSMNVFYNI 186

  Fly   166 QSWPGRRWVPESCCR-TLYDQRQVLTEGSGDGMMRPDCGRSENPSLWWDKGCAHSL-----QSWF 224
                     |||||: .|.|....|:.       |...|...|.:: :.:||...|     ::|.
  Fly   187 ---------PESCCKDNLKDNECELSR-------RLKFGGPLNNAI-YQQGCVDKLIEIIYENWV 234

  Fly   225 TGQLNVVGAVGLGIAFVQLFGLITSMLLFCTVK--HKRASDTYKSYSPSIDPQ 275
            |     :.||...:..::|..|..::.|.|.|:  |.:| :...|:....|.:
  Fly   235 T-----IFAVTAAVILLELLSLTFALSLCCAVRNQHYKAXELQNSHREITDDE 282

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp5DNP_001259266.1 Tetraspannin 8..256 CDD:278750 64/282 (23%)
NET-5_like_LEL 105..228 CDD:239418 30/152 (20%)
Tsp96FNP_001262976.1 Tetraspannin 9..261 CDD:278750 64/282 (23%)
CD151_like_LEL 107..233 CDD:239408 28/147 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR19282
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.