DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp5D and Tsp86D

DIOPT Version :9

Sequence 1:NP_001259266.1 Gene:Tsp5D / 31540 FlyBaseID:FBgn0029837 Length:287 Species:Drosophila melanogaster
Sequence 2:NP_001262468.1 Gene:Tsp86D / 41310 FlyBaseID:FBgn0037848 Length:316 Species:Drosophila melanogaster


Alignment Length:266 Identity:81/266 - (30%)
Similarity:112/266 - (42%) Gaps:51/266 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 TCIRRTFCWLNIILWLCSCAFLGAGLWLRLSYAGYATLLPQHAGLSADTIF---------MGIGG 62
            :|::.....||.:.||.....|..|:     ||....|:..:..|..|||:         |.|.|
  Fly    29 SCVKYMIFLLNFLFWLFGGLLLAIGV-----YAFMDKLMDGNGWLRLDTIYDVIFNISLVMIIAG 88

  Fly    63 T-GFVVSFFGCCGAWVQSRCLLVLYFMLIVMLFMSEFLVGSIAFLFRGGLGRTLANELRFG---I 123
            . .|.|||.||.||..::..||.||.|.:::.|:.|..:..|.|:|...:...|  |.:|.   |
  Fly    89 VIVFTVSFAGCLGALRENTWLLKLYSMCLLLFFILEMSLAIICFVFPQYMNSFL--EYQFTDKII 151

  Fly   124 ERHYNSSDRGSLVAPSVASIWDSVQQSFECCGVSS--YEDW----YDIQSWPG--RRWVPESCCR 180
            ..:.:.||..:.:        |..||.|.|||:|:  |:||    |...|.|.  |..||.|||.
  Fly   152 HSYRDDSDLQNFI--------DFAQQEFNCCGLSNAGYQDWSKNEYFNCSSPSVERCGVPYSCCI 208

  Fly   181 TLYDQRQVLTEGSGDGMMRPDCG-----RS--ENPSLWWDKGCAHSLQSWFTGQLNVVGAVGLGI 238
            ...|        ...|::...||     ||  ......|..||...::.|....|.|:..|.|||
  Fly   209 NATD--------ISSGLVNIMCGYGVQVRSVAAASKRIWTSGCIEIVRVWVERNLYVIAGVALGI 265

  Fly   239 AFVQLF 244
            |.:|||
  Fly   266 ALLQLF 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp5DNP_001259266.1 Tetraspannin 8..256 CDD:278750 81/265 (31%)
NET-5_like_LEL 105..228 CDD:239418 38/140 (27%)
Tsp86DNP_001262468.1 Tetraspannin 51..283 CDD:278750 75/244 (31%)
penumbra_like_LEL 132..255 CDD:239411 38/140 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR19282
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.