DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp5D and cd151l

DIOPT Version :9

Sequence 1:NP_001259266.1 Gene:Tsp5D / 31540 FlyBaseID:FBgn0029837 Length:287 Species:Drosophila melanogaster
Sequence 2:NP_991213.1 Gene:cd151l / 402948 ZFINID:ZDB-GENE-040426-1868 Length:254 Species:Danio rerio


Alignment Length:268 Identity:76/268 - (28%)
Similarity:129/268 - (48%) Gaps:32/268 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 GYTCIRRTFCWLNIILWLCSCAFLGAGLWLRLSYAGYATLLPQHAGLSADTIFMGIGGTGFVVSF 69
            |..|::......|.:.||...|.:..|:|..:..:.|.:||.......:..|.:..|....:...
Zfish    12 GTICLKYLLFTFNFLFWLAGVAVMAVGIWTVIEKSDYISLLSSKIYAVSAYILIMAGVIVMITGV 76

  Fly    70 FGCCGAWVQSRCLLVLYFMLIVMLFMSEFLVGSIAFLFRGGLGRTLANELRFGIERHYNSSDRGS 134
            .|||..:.:.|.||.:||:|::.:|:.|.|.|.:|:::...|...|...||..:.:.||.|::  
Zfish    77 LGCCATFKEQRRLLRVYFVLLLCIFLLEILAGVLAYIYYQQLNDELKENLRETMVQKYNQSEQ-- 139

  Fly   135 LVAPSVASIWDSVQQSFECCGVSSYEDWYDIQSW-----PGRRWVPESCCRTLYDQRQVLTEGSG 194
               ..|....|.:||.|:|||.:|..||.| .:|     ...|.||:|||::             
Zfish   140 ---EHVTKAVDKLQQEFKCCGSNSSSDWVD-SAWIRSSEADGRLVPDSCCKS------------- 187

  Fly   195 DGMMRPDCGRSENPSLWW--DKGCAHSLQSWFTGQLNVVGAVGLGIAFVQLFGLITSMLLFCTVK 257
              .:|..|||.::||..:  :.||...|:::....|.::||||:|:|.||:.|:..:..|:.::|
Zfish   188 --PVRKFCGRRDHPSNIYKVEGGCITKLENFILNHLQIIGAVGVGVASVQIVGMFFTCCLYRSLK 250

  Fly   258 HKRASDTY 265
                |:.|
Zfish   251 ----SEPY 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp5DNP_001259266.1 Tetraspannin 8..256 CDD:278750 72/254 (28%)
NET-5_like_LEL 105..228 CDD:239418 35/129 (27%)
cd151lNP_991213.1 Tetraspannin 15..249 CDD:278750 72/254 (28%)
CD151_like_LEL 112..221 CDD:239408 35/129 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm25974
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X124
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.