DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp5D and tspan35

DIOPT Version :9

Sequence 1:NP_001259266.1 Gene:Tsp5D / 31540 FlyBaseID:FBgn0029837 Length:287 Species:Drosophila melanogaster
Sequence 2:NP_956702.2 Gene:tspan35 / 393380 ZFINID:ZDB-GENE-040426-1362 Length:243 Species:Danio rerio


Alignment Length:271 Identity:72/271 - (26%)
Similarity:126/271 - (46%) Gaps:41/271 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGNAGYTCIRRTFCWL-NIILWLCSCAFLGAGLWLRLSYAGYATLLPQHAGLSADT--------I 56
            ||..|:.   :|..:| |.|::|.....||.|:|:::........:....|.|:..        :
Zfish     1 MGCFGFL---KTMMFLFNGIIFLAGGVILGVGIWVKVDNGSILNFMQSLPGASSQMGQVLNVGYL 62

  Fly    57 FMGIGGTGFVVSFFGCCGAWVQSRCLLVLYFMLIVMLFMSEFLVGSIAFLFRGGLGRTLANELRF 121
            .:.:|....|:.|.|||||..:|||:|:|:|::|:::|::| :.|:|..|....|..||..:|  
Zfish    63 LIALGAVLVVLGFLGCCGAIKESRCMLMLFFIIILIIFIAE-VAGAIVILAFRPLAETLIKQL-- 124

  Fly   122 GIERHYN-SSDRGSLVAPSVASIWDSVQQSFECCGVSSYEDWYDIQSWPGRRWVPESCCRTLYDQ 185
            |::...: .||.|.  .|.|..:|::.....:|||.::|.|:.:.......:..|..||.|    
Zfish   125 GVDAVKSLQSDFGK--NPDVTGLWNTTMTGMKCCGFNNYTDFTNSFFVNSTKNYPVQCCNT---- 183

  Fly   186 RQVLTEGSGDGMMRPDCGRSE--NPSLWWDKGCAHSLQSWFTGQLNVVGAVGLGIAFVQLFGLIT 248
                          ..|.::.  |.::   .||..:|.........::.||.||||.::|..:|.
Zfish   184 --------------SPCNQAAVMNSTV---TGCFPALIKLVDKNAVIIIAVALGIAALELAAMIV 231

  Fly   249 SMLLFCTVKHK 259
            ||:|:|.:..|
Zfish   232 SMVLYCKIGSK 242

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp5DNP_001259266.1 Tetraspannin 8..256 CDD:278750 68/259 (26%)
NET-5_like_LEL 105..228 CDD:239418 26/125 (21%)
tspan35NP_956702.2 Tetraspannin 7..239 CDD:278750 68/260 (26%)
uroplakin_I_like_LEL 116..211 CDD:239409 25/119 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X124
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.