DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp5D and zgc:64051

DIOPT Version :9

Sequence 1:NP_001259266.1 Gene:Tsp5D / 31540 FlyBaseID:FBgn0029837 Length:287 Species:Drosophila melanogaster
Sequence 2:NP_956665.1 Gene:zgc:64051 / 393342 ZFINID:ZDB-GENE-040426-1349 Length:221 Species:Danio rerio


Alignment Length:273 Identity:71/273 - (26%)
Similarity:123/273 - (45%) Gaps:71/273 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 CIRRTFCWLNIILWLCSCAFLGAGLWL----RLSYAGYATLLPQHAGLS-ADTIFMGIGGTGFV- 66
            |::...|.:|.|.::|..|..|.|::|    |||      |||....:| |:|:|:    ||.: 
Zfish     6 CLKYIMCVVNFIFFICGAAIFGMGIYLMTFSRLS------LLPSLQAMSIANTLFI----TGIII 60

  Fly    67 --VSFFGCCGAWVQSRCLLVLYFMLIVMLFMSEFLVGSIAFLFRGGLGRTLANELRFGI------ 123
              |||.|..||..::||||:.:|:|:.:|.::|.....:..::...:...:.::|..|:      
Zfish    61 TCVSFLGFLGALKENRCLLISFFILLFILMLAELAAACLMLMYESKIENFIKDDLVDGLNQSIKN 125

  Fly   124 ERHYNSSDRGSLVAPSVASIWDSVQQSFECCGVSSYEDWYDIQSWPGRRWVPESCCRTLYDQRQV 188
            .:.:|::|.           ||.||::|.|||:.:..||        :.:||:||          
Zfish   126 RKQHNTTDD-----------WDKVQETFGCCGIQNATDW--------QGFVPQSC---------- 161

  Fly   189 LTEGSGDGMMRPDCGRSENPSLWWDKGCAHSLQSWFTGQLNVVGAVGLGIAFVQLFGLITSMLLF 253
                        :...:.|    |.|||...|::.|...|...|...:.:..:::.|:..||.||
Zfish   162 ------------NISGTSN----WHKGCFKLLENSFESNLLSTGIGVIVVCIIEVLGMCFSMTLF 210

  Fly   254 CTVKHKRASDTYK 266
            |.:  .|:...||
Zfish   211 CHI--NRSGLGYK 221

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp5DNP_001259266.1 Tetraspannin 8..256 CDD:278750 68/261 (26%)
NET-5_like_LEL 105..228 CDD:239418 25/128 (20%)
zgc:64051NP_956665.1 Tetraspannin 6..213 CDD:278750 68/261 (26%)
CD53_like_LEL 101..189 CDD:239417 26/132 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1224210at2759
OrthoFinder 1 1.000 - - FOG0001172
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X124
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
65.820

Return to query results.
Submit another query.