DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp5D and Tsp42Ep

DIOPT Version :9

Sequence 1:NP_001259266.1 Gene:Tsp5D / 31540 FlyBaseID:FBgn0029837 Length:287 Species:Drosophila melanogaster
Sequence 2:NP_001260759.1 Gene:Tsp42Ep / 35626 FlyBaseID:FBgn0033137 Length:250 Species:Drosophila melanogaster


Alignment Length:303 Identity:65/303 - (21%)
Similarity:113/303 - (37%) Gaps:93/303 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 NAGYTCIRRTFCWLNIILWLCSCAFL-GAGLWLRLSYAGYATLLPQHAGLSADTIF---MGIGGT 63
            |..|..|:.|....|::..|.....: ||||.|:::...    .|:|      |.|   :.:||:
  Fly     2 NGCYNTIKYTGLLSNLLYMLLGIGVMSGAGLGLQMAEPN----TPEH------TYFVKSLVLGGS 56

  Fly    64 GFVVSFFGCCGAWVQSRCLLVLYFMLIVMLFMSEFLVGSIAFLFRGGLGRTLANELRFGIERHYN 128
            ..::..|||.|......|:.:::.|.|::...:|:|                  :|     .||:
  Fly    57 ICMIVMFGCYGMVANLLCVNLIFTMFILIALAAEYL------------------QL-----HHYH 98

  Fly   129 SSDRGSLVAPSVASIWDSV-----------------QQSFECCGVSSYEDWYDIQSWPGRRWVPE 176
            |.   ||.:|..|  |..:                 :.|..|||.:..:|:..:     ...||.
  Fly    99 SP---SLRSPGGA--WQQLELAWHGLDRDPELMHQYEASQHCCGYNGADDYKRL-----HLLVPA 153

  Fly   177 SCCRTLYDQRQVLTEGSGDGMMRPDCGRSENPSLWWDKGCAHSL---QSWF--TGQLNVVGAVGL 236
            ||.:...:                |..:...||     ||..:|   |.:.  ..:|.:...|||
  Fly   154 SCYQAAVN----------------DTAQQIYPS-----GCLETLNRSQRYIQHRDKLYMWAIVGL 197

  Fly   237 GIAFVQLFGLITSMLLFCTVKHKRASDTYKSYSPSIDPQTRTS 279
            .| |:.|..:..|:|||...:.:|.:  .:...|.:..:.|::
  Fly   198 EI-FILLQTVALSVLLFRLRQRQRIA--RRQVPPGVRREPRSN 237

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp5DNP_001259266.1 Tetraspannin 8..256 CDD:278750 60/273 (22%)
NET-5_like_LEL 105..228 CDD:239418 25/144 (17%)
Tsp42EpNP_001260759.1 Tetraspannin <51..213 CDD:278750 45/216 (21%)
tetraspanin_LEL 91..183 CDD:239401 26/145 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR19282
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.