DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp5D and Tsp42Eo

DIOPT Version :9

Sequence 1:NP_001259266.1 Gene:Tsp5D / 31540 FlyBaseID:FBgn0029837 Length:287 Species:Drosophila melanogaster
Sequence 2:NP_523641.2 Gene:Tsp42Eo / 35625 FlyBaseID:FBgn0033136 Length:219 Species:Drosophila melanogaster


Alignment Length:272 Identity:54/272 - (19%)
Similarity:94/272 - (34%) Gaps:71/272 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 IRRTFCWLNIILWLCSCAFLGAGLWLRLSYAGYATLLPQHAGLSADT---IFMGIGGTGFVVSFF 70
            :|....|.:::.   |...|..|:...|  ||...|...:.|.:..|   :.:|:.|...:....
  Fly     4 VRVCLQWTSVVF---STLTLIVGVLAAL--AGVYELDKFNEGSAEHTEKFVQLGMAGALILAGLV 63

  Fly    71 GCCGAWVQSRCLLVLYFMLIVMLFMSEFLVGSIAFLFRGGLGRTLANELRFGIERHYNSSDRGSL 135
            ||.||...|..::|:..:|::.|..|.....|                       |||.:.:...
  Fly    64 GCLGAIFGSIKVMVVNLILLLALIASHIWKVS-----------------------HYNETKQLDA 105

  Fly   136 VAPSVASIW----------DSVQQSFECCGVSSYEDWYDIQSWPGRRWVPESCCRTLYDQRQVLT 190
            ....|..:|          ..:||.:||||...:.|:..:     ...||.||..|         
  Fly   106 TEVYVMDLWMKELVHHGAMQDLQQEYECCGDKGFSDYTSL-----NMKVPRSCFHT--------- 156

  Fly   191 EGSGDGM--MRPDCGRSENPSLWWDKGCAHSLQSWFTGQLNVVGAVGLGIAFVQLFGLITSMLLF 253
               .||:  :.|           :.:||..:::..:.........|..|:...::.|:|..:.|.
  Fly   157 ---KDGIHALYP-----------YGEGCMAAVKRAYLQIYRYEKWVHCGLIGYEVVGIILGITLC 207

  Fly   254 CTVKHKRASDTY 265
            |.:.:|....||
  Fly   208 CQLTNKTRRYTY 219

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp5DNP_001259266.1 Tetraspannin 8..256 CDD:278750 51/261 (20%)
NET-5_like_LEL 105..228 CDD:239418 22/134 (16%)
Tsp42EoNP_523641.2 Tetraspannin 7..210 CDD:278750 50/258 (19%)
tetraspanin_LEL 110..178 CDD:239401 19/95 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.