DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp5D and Tsp42En

DIOPT Version :9

Sequence 1:NP_001259266.1 Gene:Tsp5D / 31540 FlyBaseID:FBgn0029837 Length:287 Species:Drosophila melanogaster
Sequence 2:NP_001260758.1 Gene:Tsp42En / 35624 FlyBaseID:FBgn0033135 Length:218 Species:Drosophila melanogaster


Alignment Length:269 Identity:58/269 - (21%)
Similarity:97/269 - (36%) Gaps:96/269 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 LNIILWLCSCAFLGAGLWLRLSYAGYATLLPQHAGLSADTIFMGIGGTGFVV--SFFGCCG---- 74
            ||::|.|.....:...:: .|:.:...|.  :|..:... ||:|.    |||  ||.||..    
  Fly    15 LNVLLSLIGVTLIALSVY-ELNSSTPGTF--EHIAIVVQ-IFVGT----FVVLTSFLGCFATARV 71

  Fly    75 ----AWVQSRCLLVLYFMLIVMLFMS-----------EFLVGSIAFLFRGGLGRTLANELRFGIE 124
                .|....|||:|..:.|.::..:           :||.             |.|:: |..:|
  Fly    72 SLGLVWSYVICLLILLCLQIYIIAAAHSTDYVERSKKDFLA-------------TWADQ-RTNVE 122

  Fly   125 RHYNSSDRGSLVAPSVASIWDSVQQSFECCGVSSYEDWYDIQSWPGRRWVPESCCRTLYDQRQVL 189
            |               .|:   ::|.:.|||.....| |.:..    |.:|.||.:.  .:|:..
  Fly   123 R---------------ISL---LEQKYSCCGQLGAHD-YILMG----RGIPLSCYKD--QERREY 162

  Fly   190 TEGSGDGMMRPDCGRSENPSLWWDKGCAHSLQSWFTGQLNVVGAVGLGIAF----VQLFGLITSM 250
            :..||                    ||..::|:..|..:    |:||.|.:    |:...|..:.
  Fly   163 SLFSG--------------------GCLQAVQAHATDNV----AIGLIIKWLLLLVEFAALGAAT 203

  Fly   251 LLFCTVKHK 259
            .|..||::|
  Fly   204 HLGITVRNK 212

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp5DNP_001259266.1 Tetraspannin 8..256 CDD:278750 55/264 (21%)
NET-5_like_LEL 105..228 CDD:239418 23/122 (19%)
Tsp42EnNP_001260758.1 Tetraspannin 8..199 CDD:278750 53/254 (21%)
tetraspanin_LEL 96..180 CDD:239401 25/142 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR19282
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.