DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp5D and Tsp42Ek

DIOPT Version :9

Sequence 1:NP_001259266.1 Gene:Tsp5D / 31540 FlyBaseID:FBgn0029837 Length:287 Species:Drosophila melanogaster
Sequence 2:NP_001246161.1 Gene:Tsp42Ek / 35621 FlyBaseID:FBgn0033133 Length:215 Species:Drosophila melanogaster


Alignment Length:263 Identity:66/263 - (25%)
Similarity:102/263 - (38%) Gaps:59/263 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 CIRRTFCWLNIILWLCSCAFLGAGLWLRLSYAGYATLLPQHAGLSADTIFMGIGGTGFVVSFFGC 72
            |::   |:||.:..|.:.:        .||....|||....|.::......|:||..||.:..||
  Fly     7 CVK---CFLNTLNTLNALS--------GLSLIAIATLALSKAPIAYILFLYGLGGIIFVSAVLGC 60

  Fly    73 CGAWVQSRCLLVLY-FMLIVMLFMSEFLVGSIAFLFRGGLGRTLANELRFGIERHYNSSDRGSLV 136
            ||..:::.|:...| |:|:..|.:|  |:|...|.|      |.....:|..|......|. .||
  Fly    61 CGICMENVCMTATYGFLLLAQLIIS--LLGIFRFKF------TEEYIEKFAAEEVQMKWDE-ELV 116

  Fly   137 APSVASIWDSVQQSFECCGVSSYEDWYDIQSWPGRRWVPESCCRTLYDQRQVLTEGSGDGMMRPD 201
            .|....|:.:|   :||||..|.:|:..|    ||:.:|.||    |.|                
  Fly   117 EPGAMDIYQTV---YECCGRDSPDDYVAI----GRQTLPPSC----YPQ---------------- 154

  Fly   202 CGRSENPSL-WWDKGCAHSLQSWFT---GQLNVVGAVGLGIAFVQLFGLITSMLLFCTVKHKRAS 262
                |:|.: .:..||.......|.   ...:....:.|||..:.   :|.:..|....:.:|..
  Fly   155 ----EDPQMPHYLAGCVQKSSENFVVLFSYAHDTNWIALGITILM---MIAAFYLVGRFRKQRVR 212

  Fly   263 DTY 265
            .||
  Fly   213 YTY 215

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp5DNP_001259266.1 Tetraspannin 8..256 CDD:278750 63/252 (25%)
NET-5_like_LEL 105..228 CDD:239418 30/126 (24%)
Tsp42EkNP_001246161.1 Tetraspannin 7..202 CDD:278750 62/248 (25%)
tetraspanin_LEL 94..174 CDD:239401 28/117 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR19282
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.