DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp5D and Tsp42Ei

DIOPT Version :9

Sequence 1:NP_001259266.1 Gene:Tsp5D / 31540 FlyBaseID:FBgn0029837 Length:287 Species:Drosophila melanogaster
Sequence 2:NP_001260756.1 Gene:Tsp42Ei / 35618 FlyBaseID:FBgn0033130 Length:229 Species:Drosophila melanogaster


Alignment Length:256 Identity:55/256 - (21%)
Similarity:108/256 - (42%) Gaps:40/256 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 GYTCIRRTFCWLNIILWLCSCAFLGAGLWLRLSYAGYATLLPQHAGLSADTIFMGIGGTGFVVSF 69
            |.|.::.....||.:..:...|.:..|::..:|.|..|..:.::.   |..:.:.:|....:::.
  Fly     4 GATTVKHVLLLLNFVFSVLGLALIAFGIFFLISAAENAVSIGKNV---AGGLIIALGVVILIIAI 65

  Fly    70 FGCCGAWVQSRCLLVLYFMLIVMLFMSEFL-VGSIAFLFRGGLGRTLANELRFGIERHYNSSDRG 133
            |||..|..::...|::|...:|:|.:::.: :|..:...:.|:..:: ||   |.:|.: .|:|.
  Fly    66 FGCLAAIHEAPVRLLIYVGAVVLLILAQLIFLGMSSHGTKDGISGSI-NE---GFDRLW-ESERN 125

  Fly   134 SLVAPSVASIWDSVQQSFECCGVSSYEDWYDIQSWPGRRWVPESCCRTLYDQRQVLTEGSGDGMM 198
            ...|.|....|      .:||||:|.||:     |.....:|.|||                   
  Fly   126 QTGALSYYESW------LQCCGVNSSEDY-----WIIHHGIPSSCC------------------- 160

  Fly   199 RPDCGRSENPSLWWDKGCAHSLQSWFTGQLNVVGAVGLGIAFVQLFGLITSMLLFCTVKHK 259
             |:....:.||..:..||..:...:...:|.|...|...:...:..|.:...||:.:||::
  Fly   161 -PESKCMDTPSRVFKTGCKAAFVKYLDDKLLVFKIVCWLLVIGEAVGAVFGWLLYSSVKNQ 220

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp5DNP_001259266.1 Tetraspannin 8..256 CDD:278750 51/248 (21%)
NET-5_like_LEL 105..228 CDD:239418 27/122 (22%)
Tsp42EiNP_001260756.1 Tetraspannin 7..217 CDD:278750 51/248 (21%)
DUF373 <17..>101 CDD:299895 16/86 (19%)
tetraspanin_LEL 104..189 CDD:239401 27/120 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR19282
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.