DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp5D and Tsp42Ee

DIOPT Version :9

Sequence 1:NP_001259266.1 Gene:Tsp5D / 31540 FlyBaseID:FBgn0029837 Length:287 Species:Drosophila melanogaster
Sequence 2:NP_001260753.1 Gene:Tsp42Ee / 35614 FlyBaseID:FBgn0029506 Length:228 Species:Drosophila melanogaster


Alignment Length:217 Identity:55/217 - (25%)
Similarity:92/217 - (42%) Gaps:52/217 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 IFMGIGGTGFVVSFFGCCGAWVQSRCLLVLY--FMLIVMLFMSEFLVGSIAFLFRGGLGRTLANE 118
            |.:.:|.....:||.|||||..:|.|:.:.|  |:||:::....|:|  :.|..|......:.|.
  Fly    57 ILISLGSIVVFISFLGCCGAIRESVCMTMSYATFLLILLILQLTFVV--LLFTHREEFENAMGNV 119

  Fly   119 LRFGIERHYNSSD--RGSLVAPSVASIWDSVQQSFECCGVSSYEDWY---DIQSWPGRRWVPESC 178
                ||..:||..  :|        .::|::|:|..|||.||..|:.   |:        ||.||
  Fly   120 ----IENAWNSEHTYKG--------GVFDTIQKSLHCCGSSSALDYIGKGDL--------VPPSC 164

  Fly   179 CRTLYDQRQVLTEGSGDGMMRPDCGRSENPSLWWDKGCAHSLQSWFTGQLNVVGAVGLGIAFVQL 243
            |             ||..::         |:.:: .||........|...:....||:|:..::|
  Fly   165 C-------------SGSCLI---------PTNYY-PGCRGKFVELMTTGSDNAKYVGIGLIGIEL 206

  Fly   244 FGLITSMLLFCTVKHKRASDTY 265
            .|.|.:..|...|::.:..:.|
  Fly   207 IGFIFACCLANNVRNYKRRNAY 228

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp5DNP_001259266.1 Tetraspannin 8..256 CDD:278750 53/206 (26%)
NET-5_like_LEL 105..228 CDD:239418 29/127 (23%)
Tsp42EeNP_001260753.1 Tetraspannin 8..219 CDD:278750 53/206 (26%)
tetraspanin_LEL 106..187 CDD:239401 28/123 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR19282
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.