DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp5D and Tsp42Ed

DIOPT Version :9

Sequence 1:NP_001259266.1 Gene:Tsp5D / 31540 FlyBaseID:FBgn0029837 Length:287 Species:Drosophila melanogaster
Sequence 2:NP_001286152.1 Gene:Tsp42Ed / 35613 FlyBaseID:FBgn0029507 Length:227 Species:Drosophila melanogaster


Alignment Length:266 Identity:55/266 - (20%)
Similarity:110/266 - (41%) Gaps:68/266 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 NIILWLCSCAFLGAGLWLRLSYAGYATLLPQHAGLSADTIFMGIGGTGFVVSFFGCCGAWVQSRC 81
            ||:..:|....:..|..:..:...::.:.......|...|.:.:|...|:|:|.|||||..::.|
  Fly    16 NILFVICGILLITFGSIMVSTIKDFSGVGETFTANSVAIIILVLGCVVFLVAFMGCCGAIRENSC 80

  Fly    82 LLVLYFMLIVMLFMSEFLVGSIAFLFRGGLGRTLANELRFGIERHYNSSDRGSLVAPSVASIW-- 144
            .|..|.:::::|.:|:..:  |.:::...:      :::..:|:             .|.:||  
  Fly    81 ALTSYSVVMLVLLVSQLAL--IIYVWVDHV------QIQQSLEK-------------IVQTIWDQ 124

  Fly   145 --------DSVQQSFECCGVSSYEDWYDIQSWPGRRWVPESCCRTLYD----QRQVLTEGSGDGM 197
                    |::|:||:|||::.:.| |.|.       .|.|||.:..:    ..||:|..|    
  Fly   125 RKTDALLMDTLQRSFKCCGLNGFAD-YGIT-------YPASCCDSPSNGTCALTQVMTRSS---- 177

  Fly   198 MRPDCGRSENPSLWWDKGCAHSLQSWFTGQLNVVGAVGLGIAFVQLFGLITSMLLFCTVKHKRAS 262
                              |..::.|::...::::...|||:..|:|...|.:.   |.....|.|
  Fly   178 ------------------CLKAVDSFWDTNVSIIKYAGLGVTAVELVAFIFAC---CLANQTRNS 221

  Fly   263 DTYKSY 268
            ...::|
  Fly   222 QRRQNY 227

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp5DNP_001259266.1 Tetraspannin 8..256 CDD:278750 52/252 (21%)
NET-5_like_LEL 105..228 CDD:239418 24/136 (18%)
Tsp42EdNP_001286152.1 Tetraspannin 8..217 CDD:278750 52/254 (20%)
tetraspanin_LEL 104..189 CDD:239401 24/133 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR19282
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.