DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp5D and Tsp29Fb

DIOPT Version :9

Sequence 1:NP_001259266.1 Gene:Tsp5D / 31540 FlyBaseID:FBgn0029837 Length:287 Species:Drosophila melanogaster
Sequence 2:NP_001137809.1 Gene:Tsp29Fb / 34212 FlyBaseID:FBgn0032075 Length:308 Species:Drosophila melanogaster


Alignment Length:274 Identity:62/274 - (22%)
Similarity:107/274 - (39%) Gaps:46/274 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 NAGYTCIRRTFCWLNIILWLCSCAFLGAGLWLRLSYAGYATLLPQHAGLSADTIFMGIGGTGFVV 67
            |:|..|.:.....::.:..|.:...:..|..::..:..::..:..|.. |...:.:.||.....|
  Fly     9 NSGMKCAKYMLIIVSFMFALTAILLIMVGTTIQTIFGDFSLFIDGHFS-SPPALLIAIGFILIAV 72

  Fly    68 SFFGCCGAWVQSRCLLVLYFMLIVMLFMSEFLVGSIAFLF----RGGLGRTLANELRFGIERHYN 128
            :..|..||..:|..::.||.:.:.::|:.|......||:.    ||.|.||:...|     ..|.
  Fly    73 AALGAYGAVKESVMVINLYGVCLFLVFILEVSAAIAAFVMQSQVRGMLIRTMNQAL-----AEYE 132

  Fly   129 SSDRGSLVAPSVASIWDSVQQSFECCGVSSYEDWYDIQS-------WPGRRWVPESCC----RTL 182
            ..       |.|.|..|.:|...|||||:..|||.|..|       ......||.|||    .:|
  Fly   133 HD-------PYVESGVDFMQSMLECCGVNEPEDWKDYLSANVNFTLGVDDVVVPNSCCGNQPTSL 190

  Fly   183 YDQRQVLTEGSGDGMMRPDCGRSENPSLWWDKGCAHSLQSWFTGQLNVVGAVGLGIAFVQLFGLI 247
            .|..|:            .|..:      :|.||...:....:....::......:|||||.|::
  Fly   191 NDSTQM------------TCMET------YDYGCFRKMNFIVSQSAMLIATGATTVAFVQLLGVL 237

  Fly   248 TSMLLFCTVKHKRA 261
            .:.:|..|::..::
  Fly   238 CAFMLAKTLRRNKS 251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp5DNP_001259266.1 Tetraspannin 8..256 CDD:278750 59/262 (23%)
NET-5_like_LEL 105..228 CDD:239418 35/137 (26%)
Tsp29FbNP_001137809.1 Tetraspannin 14..246 CDD:278750 59/262 (23%)
tetraspanin_LEL 110..218 CDD:239401 35/137 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR19282
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.