DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp5D and Tsp29Fa

DIOPT Version :9

Sequence 1:NP_001259266.1 Gene:Tsp5D / 31540 FlyBaseID:FBgn0029837 Length:287 Species:Drosophila melanogaster
Sequence 2:NP_001162915.1 Gene:Tsp29Fa / 34211 FlyBaseID:FBgn0032074 Length:248 Species:Drosophila melanogaster


Alignment Length:260 Identity:68/260 - (26%)
Similarity:115/260 - (44%) Gaps:30/260 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 GNAGYTCIRRTFCWLNIILWLCSCAFLGAGLWLRLSYAGYATLLPQHAG--LSADTIFMGIGGTG 64
            |:|  ..::.|....|:|..:.....:..|..:...|.||...|   ||  .|..|..:.||...
  Fly     6 GSA--NAVKYTLFGFNLIFLITGIILIAVGAGVGAVYTGYKLFL---AGKFFSIPTFLIVIGSFI 65

  Fly    65 FVVSFFGCCGAWVQSRCLLVLYFMLIVMLFMSEFLVGSIAFLFRGGLGRTLANELRFGIERHYNS 129
            .::|||||.||..::.||::.:.:::.::|:.|...|...::.|......:...|.:.: ..|||
  Fly    66 IIISFFGCWGALKENYCLVLSFSVMLAIIFILELAAGISGYVLRNDASDLIKTSLTYSL-NEYNS 129

  Fly   130 SDRGSLVAPSVAS-IWDSVQQSFECCGVSSYEDWYDIQSWPGRRWVPESCCRTLYDQRQVLTEGS 193
                  :.|:..: :||.:|..||||||:||.||  |.::|... :|.|||..........|   
  Fly   130 ------INPNATTKLWDDIQDEFECCGVTSYNDW--ITAFPNGD-LPISCCNVHVGAVGTFT--- 182

  Fly   194 GDGMMRPDCGRSENPSLWWDK-GCAHSLQSWFTGQLNVVGAVGLGIAFVQLFGLITSMLLFCTVK 257
                    |..:::......| ||......:.:.....:||.|:.||.:|.||:|.:..:...:|
  Fly   183 --------CNNAQSSVADRHKVGCLDGFSGYISAHAVSLGAAGVVIAILQFFGVIFACYIAREIK 239

  Fly   258  257
              Fly   240  239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp5DNP_001259266.1 Tetraspannin 8..256 CDD:278750 65/251 (26%)
NET-5_like_LEL 105..228 CDD:239418 30/124 (24%)
Tsp29FaNP_001162915.1 Tetraspannin 11..238 CDD:278750 65/250 (26%)
tetraspanin_LEL 106..210 CDD:239401 30/124 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR19282
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.