DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp5D and Tspan9

DIOPT Version :9

Sequence 1:NP_001259266.1 Gene:Tsp5D / 31540 FlyBaseID:FBgn0029837 Length:287 Species:Drosophila melanogaster
Sequence 2:NP_001101360.1 Gene:Tspan9 / 312728 RGDID:1304740 Length:330 Species:Rattus norvegicus


Alignment Length:261 Identity:77/261 - (29%)
Similarity:127/261 - (48%) Gaps:31/261 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 CIRRTFCWLNIILWLCSCAFLGAGLWLRLSYAGYATLLPQHAGLSADTIFMGIGGTGFVVSFFGC 72
            |::......|:|.|||.|..||.|:||.:|...:||..|....|||..:.:.||....|..|.||
  Rat    99 CLKYMMFLFNLIFWLCGCGLLGVGIWLSVSQGNFATFSPSFPSLSAANLVIAIGTIVMVTGFLGC 163

  Fly    73 CGAWVQSRCLLVLYFMLIVMLFMSEFLVGSIAFLFRGGLGRTLANELRFGIERHYNSSDRGSLVA 137
            .||..:::|||:.:|::::::.::|.::..:.|::...:......:|:.|: ..||:.:...|  
  Rat   164 LGAIKENKCLLLSFFIVLLIILLAELILLILFFVYMDKVNENAKQDLKEGL-LLYNTENNVGL-- 225

  Fly   138 PSVASIWDSVQQSFECCGVSSYEDWYDIQSWPGRRWVPESCCRTLYDQRQVLTEGSGDGMMRPDC 202
               .:.|:.:|....||||:.|.|||.:.   |...||:.||         :....|       |
  Rat   226 ---KNAWNIIQAEMRCCGVTDYTDWYPVL---GENTVPDRCC---------MENSQG-------C 268

  Fly   203 GRSENPSLWWDKGCAHSLQSWFTGQLNVVGAVGLGIAFVQLFGLITSMLLFCTVKHKRASDTYKS 267
            ||:....| |..||...::.||....:|:|.||:....:|:.|:..||.||..: |:    |.|.
  Rat   269 GRNSTTPL-WKTGCYEKVKLWFDDNKHVLGTVGMCFLIMQILGMAFSMTLFQHI-HR----TGKK 327

  Fly   268 Y 268
            |
  Rat   328 Y 328

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp5DNP_001259266.1 Tetraspannin 8..256 CDD:278750 73/247 (30%)
NET-5_like_LEL 105..228 CDD:239418 31/122 (25%)
Tspan9NP_001101360.1 Tetraspannin 100..317 CDD:395265 70/242 (29%)
NET-5_like_LEL 196..293 CDD:239418 31/122 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 138 1.000 Domainoid score I4711
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H4860
Inparanoid 1 1.050 141 1.000 Inparanoid score I4397
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1224210at2759
OrthoFinder 1 1.000 - - FOG0001172
OrthoInspector 1 1.000 - - otm45499
orthoMCL 1 0.900 - - OOG6_108304
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X124
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
109.870

Return to query results.
Submit another query.