DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp5D and Tspan18

DIOPT Version :9

Sequence 1:NP_001259266.1 Gene:Tsp5D / 31540 FlyBaseID:FBgn0029837 Length:287 Species:Drosophila melanogaster
Sequence 2:NP_001101220.1 Gene:Tspan18 / 311210 RGDID:1560411 Length:248 Species:Rattus norvegicus


Alignment Length:263 Identity:71/263 - (26%)
Similarity:130/263 - (49%) Gaps:41/263 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 TCIRRTFCWLNIILWLCSCAFLGAGLWLRLSYAGYATLLPQHAGLSADT-IFMGIGGTGFVVSFF 70
            :|::......|..::|.....||.|:|:.:...|:..::..:..|:... :.:.:||..|::.|.
  Rat     7 SCMKYLMFVFNFFVFLGGACLLGVGIWVLVDPTGFREIVATNPLLTTGAYVVLAMGGLLFLLGFL 71

  Fly    71 GCCGAWVQSRCLLVLYFMLIVMLFMSEFLVGSIAFLFRGGLGRTLANELRFGIERHY---NSSDR 132
            |||||..::||||:.:|:.|:::|:.|.....:||:||..|.|....:   .:.:||   |.:| 
  Rat    72 GCCGAVRENRCLLLFFFLFILIIFLVELSAAILAFIFREHLTREFFTK---ELTKHYQGDNDTD- 132

  Fly   133 GSLVAPSVASIWDSVQQSFECCGVSSYEDW----------YDIQSWPGRRWVPESCCRTLYDQRQ 187
                  ..::.|:||..:|.||||:..||:          .|.:.      ||::|||     |:
  Rat   133 ------VFSATWNSVMITFGCCGVNGPEDFKLASVFRLLTLDTEE------VPKACCR-----RE 180

  Fly   188 VLTEGSGDGMM--RPDCGRSENPSLWWDKGCAHSLQSWFTGQLNVVGAVGLGIAFVQLFGLITSM 250
            ..|.   ||::  |.:|....||.: ..:||...:.:.|...:.:.||..:|:..::||.::.:|
  Rat   181 PQTR---DGVVLSREECQLGRNPFI-NKQGCYTVILNTFETYVYLAGAFAIGVLAIELFLMVFAM 241

  Fly   251 LLF 253
            .||
  Rat   242 CLF 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp5DNP_001259266.1 Tetraspannin 8..256 CDD:278750 71/262 (27%)
NET-5_like_LEL 105..228 CDD:239418 36/137 (26%)
Tspan18NP_001101220.1 Tetraspannin 10..243 CDD:395265 68/257 (26%)
uroplakin_I_like_LEL 105..218 CDD:239409 37/137 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X124
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.