DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp5D and Tsp2A

DIOPT Version :9

Sequence 1:NP_001259266.1 Gene:Tsp5D / 31540 FlyBaseID:FBgn0029837 Length:287 Species:Drosophila melanogaster
Sequence 2:NP_001188523.1 Gene:Tsp2A / 31080 FlyBaseID:FBgn0024361 Length:244 Species:Drosophila melanogaster


Alignment Length:264 Identity:59/264 - (22%)
Similarity:105/264 - (39%) Gaps:48/264 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 CIRRTFCWLNIILWLCSCAFLGAGLWLRL--SYAGYATLLPQHAGLSADTIFMGIGGTGFVVSFF 70
            |::.|....||:.|:.|.|.....:|||.  .:..:..:|...:......:.:||......|||.
  Fly    18 CVKYTLFCFNIVAWMISTALFALTVWLRAEPGFNDWLRILEAQSFYIGVYVLIGISIVMMAVSFL 82

  Fly    71 GCCGAWVQSRCLLVLYFMLIVMLFMSEFLVGSIAFLFRGGLGRTLANELRFGIERHYNSSDRGSL 135
            ||..|.:::...|.::....|..|:: .:.||...|....:..:|...|        |.|.|| .
  Fly    83 GCLSALMENTLALFVFVGTQVFGFIA-IVAGSAVLLQFSTINSSLQPLL--------NVSLRG-F 137

  Fly   136 VAPSVAS----IWDSVQQSFECCGVSSYEDWYDIQSWPGRRWVPESCCRTLYDQRQVLTEGSGDG 196
            ||.|..:    :...:|::..|||.:...|:.|:     |:.:|.||..|:          ||:.
  Fly   138 VATSEYTYSNYVLTMIQENIGCCGATGPWDYLDL-----RQPLPSSCRDTV----------SGNA 187

  Fly   197 MMRPDCGRSENPSLWWDKGCAHSLQSWFTGQLNVVGAVGLGIAFVQLFGLITSMLLFCTVK--HK 259
            ..               .||...|..:|.|:...:.|:.:.:..:.:...:.|.:|...||  .:
  Fly   188 FF---------------NGCVDELTWFFEGKTGWIVALAMTLGLLNVICAVMSFVLVQAVKKEEE 237

  Fly   260 RASD 263
            :||:
  Fly   238 QASN 241

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp5DNP_001259266.1 Tetraspannin 8..256 CDD:278750 55/253 (22%)
NET-5_like_LEL 105..228 CDD:239418 28/126 (22%)
Tsp2ANP_001188523.1 Tetraspannin 18..232 CDD:278750 55/253 (22%)
tetraspanin_LEL 116..204 CDD:239401 28/126 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR19282
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.