DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp5D and Tspan4

DIOPT Version :9

Sequence 1:NP_001259266.1 Gene:Tsp5D / 31540 FlyBaseID:FBgn0029837 Length:287 Species:Drosophila melanogaster
Sequence 2:XP_038963951.1 Gene:Tspan4 / 293627 RGDID:1305810 Length:333 Species:Rattus norvegicus


Alignment Length:249 Identity:73/249 - (29%)
Similarity:119/249 - (47%) Gaps:29/249 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 NIILWLCSCAFLGAGLWLRLSYAGYATLLPQHAGLSADTIFMGIGGTGFVVSFFGCCGAWVQSRC 81
            |::.||..|..||.|:||..:...:|||......|||..:.:..|.....:.|.||.||..:::|
  Rat   112 NLLFWLGGCGVLGVGIWLAATQGNFATLSSSFPSLSAANLLIVTGTFVMAIGFVGCIGALKENKC 176

  Fly    82 LLVLYFMLIVMLFMSEFLVGSIAFLFRGGLGRTLANELRFGIERHYNSSDRGSLVAPSVASIWDS 146
            ||:.:|:|::::|:.|..:..:.|.:...:......:|:.|:..:....:.|      :.:.|..
  Rat   177 LLLTFFVLLLLVFLLEATIAVLFFAYSDKIDSYAQQDLKKGLHLYGTEGNVG------LTNAWSI 235

  Fly   147 VQQSFECCGVSSYEDWYDIQSWPGRRWVPESCCRTLYDQRQVLTEGSGDGMMRPDCGRSENPSLW 211
            :|..|.|||||:|.||:::.:   ...||:|||....|                .||..| |..|
  Rat   236 IQTDFRCCGVSNYTDWFEVYN---ATRVPDSCCLEFSD----------------SCGLHE-PGTW 280

  Fly   212 WDKGCAHSLQSWFTGQLNVVGAVGLGIAFVQLFGLITSMLLFCTVKHKRASDTY 265
            |...|..::::|....|..||..||..|.||:.||..:|.::|.|.   .:|||
  Rat   281 WKSPCYETVKAWLQENLLAVGIFGLCTALVQILGLTFAMTMYCQVV---KADTY 331

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp5DNP_001259266.1 Tetraspannin 8..256 CDD:278750 69/238 (29%)
NET-5_like_LEL 105..228 CDD:239418 29/122 (24%)
Tspan4XP_038963951.1 Tetraspannin 104..321 CDD:395265 68/234 (29%)
NET-5_like_LEL 200..297 CDD:239418 29/122 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 138 1.000 Domainoid score I4711
eggNOG 1 0.900 - - E1_KOG3882
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 141 1.000 Inparanoid score I4397
OMA 1 1.010 - - QHG45282
OrthoDB 1 1.010 - - D1224210at2759
OrthoFinder 1 1.000 - - FOG0001172
OrthoInspector 1 1.000 - - otm45499
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X124
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
109.880

Return to query results.
Submit another query.