DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp5D and Tspan12

DIOPT Version :9

Sequence 1:NP_001259266.1 Gene:Tsp5D / 31540 FlyBaseID:FBgn0029837 Length:287 Species:Drosophila melanogaster
Sequence 2:NP_766595.1 Gene:Tspan12 / 269831 MGIID:1889818 Length:305 Species:Mus musculus


Alignment Length:282 Identity:61/282 - (21%)
Similarity:106/282 - (37%) Gaps:67/282 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 CIRRTFCWLNIILWLCSCAFLGAGLWLRLSYAGYATLLPQ---------------HAGLSADTIF 57
            |:|.....||::.||.|.:.|....|:|.......||..:               |..:.|...|
Mouse     9 CLRCLLYALNLLFWLMSISVLAVSAWMRDYLNNVLTLTAETRVEEAVILTYFPVVHPVMIAVCCF 73

  Fly    58 MGIGGTGFVVSFFGCCGAWVQSRCLLVLYFMLIVMLFMSEFLVGSIAF-------LFRGGLGRTL 115
            :      .:|...|.||...::..||..||..::::|..|...|...:       :....:....
Mouse    74 L------IIVGMLGYCGTVKRNLLLLAWYFGTLLVIFCVELACGVWTYEQEVMVPVQWSDMVTLK 132

  Fly   116 ANELRFGIERHYNSSDRGSLVAPSVASIWDSVQQSFECCGVSSYEDWYDI--QSWPGRRWVPESC 178
            |....:|:.|:           ..:...|:..|:.|:||||..:.||.::  ..||     |:||
Mouse   133 ARMTNYGLPRY-----------RWLTHAWNYFQREFKCCGVVYFTDWLEMTEMDWP-----PDSC 181

  Fly   179 CRTLYDQRQVLTEGSGDGMMRPDCGR---SENPSLWWDKGCAHSLQSWFTG--QLNVVGAVGLGI 238
            |...:                |.|.:   .|:.|..:.:||...:.|:..|  ||.|:..:|:.|
Mouse   182 CVREF----------------PGCSKQAHQEDLSDLYQEGCGKKMYSFLRGTKQLQVLRFLGISI 230

  Fly   239 AFVQLFGLITSMLLFCTVKHKR 260
            ...|:..:|.::.|...:.:.|
Mouse   231 GVTQILAMILTITLLWALYYDR 252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp5DNP_001259266.1 Tetraspannin 8..256 CDD:278750 60/276 (22%)
NET-5_like_LEL 105..228 CDD:239418 26/136 (19%)
Tspan12NP_766595.1 Tetraspannin 10..244 CDD:366035 58/271 (21%)
TM4SF12_like_LEL 116..218 CDD:239410 26/133 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
32.770

Return to query results.
Submit another query.