DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp5D and TSPAN12

DIOPT Version :9

Sequence 1:NP_001259266.1 Gene:Tsp5D / 31540 FlyBaseID:FBgn0029837 Length:287 Species:Drosophila melanogaster
Sequence 2:NP_036470.1 Gene:TSPAN12 / 23554 HGNCID:21641 Length:305 Species:Homo sapiens


Alignment Length:285 Identity:65/285 - (22%)
Similarity:107/285 - (37%) Gaps:73/285 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 CIRRTFCWLNIILWLCSCAFLGAGLWLRLSYAGYATLLPQ---------------HAGLSADTIF 57
            |:|.....||::.||.|.:.|....|:|.......||..:               |..:.|...|
Human     9 CLRCLLYALNLLFWLMSISVLAVSAWMRDYLNNVLTLTAETRVEEAVILTYFPVVHPVMIAVCCF 73

  Fly    58 MGIGGTGFVVSFFGCCGAWVQSRCLLVLYFMLIVMLFMSEFLVGSIAFLFRGGLGRTLANELRFG 122
            :      .:|...|.||...::..||..||..::::|..|...|.          .|...||...
Human    74 L------IIVGMLGYCGTVKRNLLLLAWYFGSLLVIFCVELACGV----------WTYEQELMVP 122

  Fly   123 IERHYNSSDRGSLVAPS----------VASIWDSVQQSFECCGVSSYEDWYDI--QSWPGRRWVP 175
            ::    .||..:|.|..          :...|:..|:.|:||||..:.||.::  ..||     |
Human   123 VQ----WSDMVTLKARMTNYGLPRYRWLTHAWNFFQREFKCCGVVYFTDWLEMTEMDWP-----P 178

  Fly   176 ESCCRTLYDQRQVLTEGSGDGMMRPDCGR---SENPSLWWDKGCAHSLQSWFTG--QLNVVGAVG 235
            :|||...:                |.|.:   .|:.|..:.:||...:.|:..|  ||.|:..:|
Human   179 DSCCVREF----------------PGCSKQAHQEDLSDLYQEGCGKKMYSFLRGTKQLQVLRFLG 227

  Fly   236 LGIAFVQLFGLITSMLLFCTVKHKR 260
            :.|...|:..:|.::.|...:.:.|
Human   228 ISIGVTQILAMILTITLLWALYYDR 252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp5DNP_001259266.1 Tetraspannin 8..256 CDD:278750 64/279 (23%)
NET-5_like_LEL 105..228 CDD:239418 30/139 (22%)
TSPAN12NP_036470.1 Tetraspannin 10..244 CDD:395265 62/274 (23%)
TM4SF12_like_LEL 116..218 CDD:239410 29/126 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
32.770

Return to query results.
Submit another query.