DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp5D and Tspan7

DIOPT Version :10

Sequence 1:NP_001259266.1 Gene:Tsp5D / 31540 FlyBaseID:FBgn0029837 Length:287 Species:Drosophila melanogaster
Sequence 2:NP_062608.2 Gene:Tspan7 / 21912 MGIID:1298407 Length:249 Species:Mus musculus


Alignment Length:69 Identity:16/69 - (23%)
Similarity:27/69 - (39%) Gaps:21/69 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   622 QLAQSPRSLINLSNYSGGPTPQELLDVIDDNDI-CCSTPSLSR--------------------CP 665
            ::.|.|..|:....:..||...:.||::|.:.: |.|:||..:                    ||
Mouse    22 EIKQIPDDLLIALRFVFGPCALQALDLVDQHSVTCVSSPSGRKAFQVLGGSGRLYTCFTSCHYCP 86

  Fly   666 SAAF 669
            ..||
Mouse    87 CPAF 90

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp5DNP_001259266.1 Tetraspanin 9..254 CDD:459767
NET-5_like_LEL 105..228 CDD:239418
Tspan7NP_062608.2 Tetraspanin 15..239 CDD:459767 16/69 (23%)
TM4SF2_6_like_LEL 110..213 CDD:239414
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.