DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp5D and Tspan8

DIOPT Version :9

Sequence 1:NP_001259266.1 Gene:Tsp5D / 31540 FlyBaseID:FBgn0029837 Length:287 Species:Drosophila melanogaster
Sequence 2:NP_001162150.1 Gene:Tspan8 / 216350 MGIID:2384918 Length:235 Species:Mus musculus


Alignment Length:259 Identity:63/259 - (24%)
Similarity:117/259 - (45%) Gaps:35/259 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 TCIRRTFCWLNIILWLCSCAFLGAGLWLRLSYAGYATLLPQHAGLS---ADTIFMGIGGTGFVVS 68
            :|::.:..:.|.:.|:|....||..:|:|:|..|...:....:..:   |..|.:.:|....|:.
Mouse     6 SCLKYSMFFFNFLFWVCGTLILGLAIWVRVSKDGKEIITSGDSSTNPFIAVNILIAVGSIIMVLG 70

  Fly    69 FFGCCGAWVQSRCLLVLYFMLIVMLFMSEFLVGSIAFLFRGGLGRTLANELRFGIERHYNSSDRG 133
            |.|||||..:|||:|:|:|:.::::.:.:...|.:...|:....|.|...|....:...:::|. 
Mouse    71 FLGCCGAVKESRCMLLLFFIGLLLILILQVAAGILGAAFKPEYNRILNETLYENAKLLSDNTDE- 134

  Fly   134 SLVAPSVASIWDSVQQSFECCGV-SSYEDWYDIQSWPGRRWV--PESCCRTLYDQRQVLTEGSGD 195
               |..........|..|:|||: :...||       |..:|  .|||..|          |:  
Mouse   135 ---AKDFQKAMIVFQSEFKCCGLENGAADW-------GNNFVEAKESCQCT----------GT-- 177

  Fly   196 GMMRPDCGRSENPSLWWDKGCAHSLQSWFTGQLNVVGAVGLGIAFVQLFGLITSMLLFCTVKHK 259
                 ||...:..|: :.|.|...::..|...:.:|..:..|:|.:::.||:.||:|:|.:..|
Mouse   178 -----DCATYQGSSV-YPKTCLSLIKDLFEKNIIIVIGIAFGLAVIEILGLVFSMVLYCQIGSK 235

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp5DNP_001259266.1 Tetraspannin 8..256 CDD:278750 62/253 (25%)
NET-5_like_LEL 105..228 CDD:239418 26/125 (21%)
Tspan8NP_001162150.1 Tetraspannin 8..228 CDD:366035 59/248 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X124
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.