DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp5D and tspan18

DIOPT Version :9

Sequence 1:NP_001259266.1 Gene:Tsp5D / 31540 FlyBaseID:FBgn0029837 Length:287 Species:Drosophila melanogaster
Sequence 2:NP_001093673.1 Gene:tspan18 / 100101661 XenbaseID:XB-GENE-868385 Length:247 Species:Xenopus tropicalis


Alignment Length:265 Identity:74/265 - (27%)
Similarity:134/265 - (50%) Gaps:46/265 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 TCIRRTFCWLNIILWLCSCAFLGAGLWLRLSYAGYATLLPQHAGLSADTIFMG------IGGTGF 65
            :||:......|..::|.....||.|:|:.:...|:..::     .:...:|||      :||..|
 Frog     7 SCIKYLMFIFNFFIFLGGATLLGLGVWVFVDPTGFREII-----ATTPLLFMGAYLVLAMGGMLF 66

  Fly    66 VVSFFGCCGAWVQSRCLLVLYFMLIVMLFMSEFLVGSIAFLFRGGLGRT-LANELRFGIERHYNS 129
            ::.|.|||||..:::||||.:||.|:::|::|.....:|||||..|.:. .|.|    :::||:.
 Frog    67 LLGFLGCCGAIRENKCLLVFFFMFILVIFLAELSAAILAFLFRENLSKDFFARE----VKKHYHG 127

  Fly   130 SDRGSLVAPSVASIWDSVQQSFECCGVSSYEDWYDIQSW-------PGRRWVPESCCRTLYDQRQ 187
            .:...:    .:|.|:|:..:|.||||:..||:.|...:       |    |||:|||     |:
 Frog   128 DNSTEV----FSSTWNSIMITFGCCGVNGPEDFNDAHRFRAMHPFAP----VPEACCR-----RE 179

  Fly   188 VLTEGSGDGMMRPDC---GRS-ENPSLWWDKGCAHSLQSWFTGQLNVVGAVGLGIAFVQLFGLIT 248
            |.:. :|..:.|.:|   |.: :|     .:||...:.:.....:.:.||:.:|:..::|..::.
 Frog   180 VQSR-AGKIVSRAECLTGGENYQN-----RQGCYSVIVNSVEPYVYIAGALAIGVLAIELLSMVF 238

  Fly   249 SMLLF 253
            :|.||
 Frog   239 AMCLF 243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp5DNP_001259266.1 Tetraspannin 8..256 CDD:278750 74/264 (28%)
NET-5_like_LEL 105..228 CDD:239418 36/134 (27%)
tspan18NP_001093673.1 Tetraspannin 9..242 CDD:395265 71/260 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X124
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.