DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5921 and SLC9A3R2

DIOPT Version :9

Sequence 1:NP_727061.2 Gene:CG5921 / 31538 FlyBaseID:FBgn0029835 Length:886 Species:Drosophila melanogaster
Sequence 2:XP_016879383.1 Gene:SLC9A3R2 / 9351 HGNCID:11076 Length:372 Species:Homo sapiens


Alignment Length:215 Identity:56/215 - (26%)
Similarity:88/215 - (40%) Gaps:51/215 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 TNSASTDCSSSM--QGSTTSSASSDVMTLTTTAASSWCAIPAS--SRLRV---LRLVRP---HQR 72
            |.:....|::.|  .||.|..|.:.            .|.|.|  .||.|   ||.:||   |.|
Human   149 TPATCCHCAAVMARSGSATPPARAP------------GAPPRSPPQRLDVSGPLRELRPRLCHLR 201

  Fly    73 RLLVGGPERGSTYGFTVRGGREHGTGFFVSHVEHGGEAHLKGLRIGDQILRINGFRLDDAVHKEF 137
            :    ||:   .|||.:...:.. .|.::..|:.|..|...|||..|:::.:||..::...|.|.
Human   202 K----GPQ---GYGFNLHSDKSR-PGQYIRSVDPGSPAARSGLRAQDRLIEVNGQNVEGLRHAEV 258

  Fly   138 I-QLVAGQDRVTLKVRGVGMLPVRDLPEERLSWSVVK------LPS--VSGTP-------SESSF 186
            : .:.|.:|...|.|    :.|..|...:||..:..:      |||  .:||.       |..|.
Human   259 VASIKAREDEARLLV----VDPETDEHFKRLRVTPTEEHVEGPLPSPVTNGTSPAQLNGGSACSS 319

  Fly   187 KGERRGASRDISVV-LHVAP 205
            :.:..|:.:|.... ||::|
Human   320 RSDLPGSDKDTEESGLHLSP 339

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5921NP_727061.2 PDZ_signaling 82..152 CDD:238492 18/70 (26%)
PDZ_signaling 197..276 CDD:238492 3/10 (30%)
SLC9A3R2XP_016879383.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3528
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.