DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5921 and PDZD3

DIOPT Version :9

Sequence 1:NP_727061.2 Gene:CG5921 / 31538 FlyBaseID:FBgn0029835 Length:886 Species:Drosophila melanogaster
Sequence 2:XP_011541302.1 Gene:PDZD3 / 79849 HGNCID:19891 Length:571 Species:Homo sapiens


Alignment Length:280 Identity:68/280 - (24%)
Similarity:105/280 - (37%) Gaps:81/280 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 MTLTTTAASSWCAIPASSRLRVL-----------RLVRP-----HQRRLLVGGP----------- 79
            :.|:|..|:....:|..:||..:           :|.|.     .|..|||.||           
Human   247 LVLSTGGAAERAGVPPGARLLEVNGVSVEKFTHNQLTRKLWQSGQQVTLLVAGPEVEEQCRQLGL 311

  Fly    80 ---------------------ERG-STYGFTVR--GGREHGTGFFVSHVEHGGEAHLKGLRIGDQ 120
                                 |:| ..:||.:|  .|.:...|.|:..|:.|..|...|::.||:
Human   312 PLAAPLAEGWALPTKPRCLHLEKGPQGFGFLLREEKGLDGRPGQFLWEVDPGLPAKKAGMQAGDR 376

  Fly   121 ILRINGFRLDDAVHKEFIQLVAGQDRVTLKVRGVGMLPVRDLPEERLSWSVVKLPS---VSGTPS 182
            ::.:.|..::...|:|.:..:.||....       .|.|.| ||....:|:|:|..   :..|.:
Human   377 LVAVAGESVEGLGHEETVSRIQGQGSCV-------SLTVVD-PEADRFFSMVRLSPLLFLENTEA 433

  Fly   183 ESSFKGERRGA---SRDISVVLHVAPRTKLGLGIC---KGPEWK-----------PGIFV-QFTK 229
            .:|.:|....:   :.|.|:.....|...||...|   .||...           |.:|: |.|.
Human   434 PASPRGSSSASLVETEDPSLEDTSVPSVPLGSRQCFLYPGPGGSYGFRLSCVASGPRLFISQVTP 498

  Fly   230 DRSVAREAGLRPGDQILSVN 249
            ..|.|| |||:.||.||.||
Human   499 GGSAAR-AGLQVGDVILEVN 517

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5921NP_727061.2 PDZ_signaling 82..152 CDD:238492 18/72 (25%)
PDZ_signaling 197..276 CDD:238492 23/68 (34%)
PDZD3XP_011541302.1 PDZ_signaling 113..193 CDD:238492
PDZ_signaling 221..298 CDD:238492 11/50 (22%)
PDZ 326..411 CDD:214570 22/92 (24%)
PDZ_signaling 466..545 CDD:238492 19/53 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3528
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.