powered by:
Protein Alignment CG5921 and si:dkey-276j7.2
DIOPT Version :9
Sequence 1: | NP_727061.2 |
Gene: | CG5921 / 31538 |
FlyBaseID: | FBgn0029835 |
Length: | 886 |
Species: | Drosophila melanogaster |
Sequence 2: | XP_017212076.1 |
Gene: | si:dkey-276j7.2 / 792667 |
ZFINID: | ZDB-GENE-131127-420 |
Length: | 250 |
Species: | Danio rerio |
Alignment Length: | 57 |
Identity: | 17/57 - (29%) |
Similarity: | 32/57 - (56%) |
Gaps: | 11/57 - (19%) |
- Green bases have known domain annotations that are detailed below.
Fly 225 VQFTKDRSVAREAGLRPGDQILSVNSIDFSDV-------LFSEA----VAVMKSSSK 270
|.|.|:.|:|..:||...|.|::|||:..::. ||.:| :.:::||::
Zfish 96 VCFVKEDSLAESSGLMTDDVIIAVNSVSIAEFTQQQLKDLFQKASILMLEIVRSSTE 152
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
CG5921 | NP_727061.2 |
PDZ_signaling |
82..152 |
CDD:238492 |
|
PDZ_signaling |
197..276 |
CDD:238492 |
17/57 (30%) |
si:dkey-276j7.2 | XP_017212076.1 |
None |
Blue background indicates that the domain is not in
the aligned region.
|
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_KOG3528 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
ZFIN |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.