DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5921 and Pdzd11

DIOPT Version :9

Sequence 1:NP_727061.2 Gene:CG5921 / 31538 FlyBaseID:FBgn0029835 Length:886 Species:Drosophila melanogaster
Sequence 2:NP_001343313.1 Gene:Pdzd11 / 72621 MGIID:1919871 Length:140 Species:Mus musculus


Alignment Length:145 Identity:45/145 - (31%)
Similarity:64/145 - (44%) Gaps:28/145 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   157 LPVRDLPEERLSWSVVKLPSVSGTPS---------ESSFKGERRGASRDISVVLHVAPRTKLGLG 212
            :|..|.|       ||.||:....|:         ...:..|.......| |.|...|..:||..
Mouse     5 IPYDDYP-------VVFLPAYENPPAWIPPHERVYHPDYNNELTQFLPRI-VTLKKPPGAQLGFN 61

  Fly   213 ICKGPEWKPGIFVQFTKDRSVAREAGLRPGDQILSVNSIDFSDVLFSEAVAVMKSSSKLDMVVRT 277
            |..|...:.|||:......|.|..|||:.|||:|:||.:||.|:..|:||.::|::.::.|.|| 
Mouse    62 IRGGKASQLGIFISKVIPDSDAHRAGLQEGDQVLAVNDVDFQDIEHSKAVEILKTAREISMRVR- 125

  Fly   278 AAGCDLFPGESSGYN 292
                 .||     ||
Mouse   126 -----FFP-----YN 130

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5921NP_727061.2 PDZ_signaling 82..152 CDD:238492
PDZ_signaling 197..276 CDD:238492 30/78 (38%)
Pdzd11NP_001343313.1 PDZ_signaling 45..125 CDD:238492 30/80 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3528
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.