DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5921 and Pdzk1

DIOPT Version :9

Sequence 1:NP_727061.2 Gene:CG5921 / 31538 FlyBaseID:FBgn0029835 Length:886 Species:Drosophila melanogaster
Sequence 2:NP_113900.1 Gene:Pdzk1 / 65144 RGDID:70924 Length:523 Species:Rattus norvegicus


Alignment Length:329 Identity:76/329 - (23%)
Similarity:123/329 - (37%) Gaps:77/329 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    80 ERGSTYGFTVRGGREHGTGFFVSHVEHGGEAHLKGLRIGDQILRINGFRLDDAVHKEFIQLV--A 142
            :.|..|||.:|..:: ..|..|..:|.|..|...||..||::|||||..:|...|.:.:.||  :
  Rat    15 KEGQNYGFFLRIEKD-TDGHLVRVIEEGSPAEKAGLLDGDRVLRINGVFVDKEEHAQVVDLVRKS 78

  Fly   143 GQDRVTLKVRGVGMLPVRDLPEERLSWSVVKLPSVSGTPSESSFKGERRGASRDISVVLHVAPR- 206
            |.....|.:.|       |..|:.:... |.|..:..:|.|.:...::.....:..|.....|| 
  Rat    79 GNSVTLLVLDG-------DSYEKAVKHQ-VDLKELDQSPREPALNEKKPDLGMNGGVETCAQPRL 135

  Fly   207 -------TKLGLGICKGPEWKPGIFVQFTKDRSVAREAGLRPGDQILSVNSIDFSDVLFSEAV-A 263
                   ...|..: |..:.|.|:|:.....:.||.:||:...|.::.||..:..:....|.| .
  Rat   136 CYLVKEGNSFGFSL-KTIQGKKGVFLTDITPQGVAMKAGVLADDHLIEVNGENVENASHEEVVEK 199

  Fly   264 VMKSSSKLDMVVRTAAGCDLFPGESSGYNSSASSVTGDQSPCWADAKS--KRLTA---------- 316
            |.||.|::..::                      |..:.:.|.::.|:  ||.||          
  Rat   200 VTKSGSRIMFLL----------------------VDKETARCHSEQKTPFKRETASLKLLPHQPR 242

  Fly   317 -VREESGAGGGGCGLSSAPGAGSPNWSQGVEVHKQMNKTIIKLTENGTSI------NNTYIASTG 374
             |..:.|:.|.|..|.:.|               :....|||..|.|:..      ||..:.:..
  Rat   243 VVVIKKGSNGYGFYLRAGP---------------EQKGQIIKDIEPGSPAEAAGLKNNDLVVAVN 292

  Fly   375 GSSV 378
            |.||
  Rat   293 GESV 296

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5921NP_727061.2 PDZ_signaling 82..152 CDD:238492 25/71 (35%)
PDZ_signaling 197..276 CDD:238492 21/87 (24%)
Pdzk1NP_113900.1 PDZ_signaling 7..87 CDD:238492 25/72 (35%)
PDZ 132..212 CDD:214570 20/102 (20%)
PDZ_signaling 242..320 CDD:238492 16/70 (23%)
PDZ 375..455 CDD:214570
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 479..523
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3528
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.