DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5921 and CG10939

DIOPT Version :9

Sequence 1:NP_727061.2 Gene:CG5921 / 31538 FlyBaseID:FBgn0029835 Length:886 Species:Drosophila melanogaster
Sequence 2:NP_524712.1 Gene:CG10939 / 44155 FlyBaseID:FBgn0010620 Length:296 Species:Drosophila melanogaster


Alignment Length:321 Identity:68/321 - (21%)
Similarity:116/321 - (36%) Gaps:91/321 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   213 ICKGPEW------------KPGIFVQFTKDRSVAREAGLRPGDQILSVNSIDFSDVLFSEAVAVM 265
            |.|.|::            |||.|:......|.|..|||:.||:||.||.:........:.||.:
  Fly    25 IVKRPDFDGYGFNLHSEKVKPGQFIGKVDADSPAEAAGLKEGDRILEVNGVSIGSETHKQVVARI 89

  Fly   266 KSSSK------LDMVVRT---------AAGCDLFPGESS----GYNSSASSVTGDQSPCWADAKS 311
            |:.:.      :|:..:.         ||.|:   |..|    ||..:...:.|..    |:..|
  Fly    90 KAIANEVRLLLIDVDGKALEVKPASPPAAACN---GNGSASQNGYEGTKQEMPGAS----ANISS 147

  Fly   312 KRLTAVREESGAGGGGCGLSSAPGAGSPNWSQGVEVHKQMNKTIIKLTENGTSINNTYIASTGGS 376
            ..:.:.:..|.|        |:..:||           .||.:.:.:.:.|.......:|.|...
  Fly   148 ISMVSTKRSSNA--------SSIQSGS-----------TMNASDLDVVDRGIPAVAAPVAITPPP 193

  Fly   377 SVSGSGSTGSGTSGRSQQSQSNPSNPSRNSTTMKRSHLRPVNSAGSGIGLSSGSAGSAGSAGSSG 441
            ..:|                |.||:|..|:|.|  |...|.::..:||. ::||..:.       
  Fly   194 VQNG----------------SKPSSPINNNTLM--STPPPPSATKAGIN-NNGSVYNT------- 232

  Fly   442 SGSRSGGVIAPAPAPPPPAMNEGANASGSVGSSLSSAITEELKKRKEKQQQQQHQQRHNRD 502
            :|:.:.|:..|...|||        .||....:|...:|....:.|...:::...:..:.|
  Fly   233 NGNGTNGMTTPTTPPPP--------TSGYKAGTLHLPMTAAEMRAKLASKKKYDPKNESVD 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5921NP_727061.2 PDZ_signaling 82..152 CDD:238492
PDZ_signaling 197..276 CDD:238492 22/80 (28%)
CG10939NP_524712.1 PDZ_signaling 20..101 CDD:238492 21/75 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3528
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.