DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5921 and CG15617

DIOPT Version :9

Sequence 1:NP_727061.2 Gene:CG5921 / 31538 FlyBaseID:FBgn0029835 Length:886 Species:Drosophila melanogaster
Sequence 2:NP_611151.1 Gene:CG15617 / 36871 FlyBaseID:FBgn0034151 Length:222 Species:Drosophila melanogaster


Alignment Length:190 Identity:46/190 - (24%)
Similarity:69/190 - (36%) Gaps:41/190 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    85 YGFTVRGGREHGTGFFVSHVEHGGEAHLKGLRIGDQILRINGFRLDDAVHKEFIQLVAGQDR-VT 148
            :|..|.||.:......:.:|...|.|...|:|:||:|.:||.....:....|.:|:.....| |.
  Fly    43 WGMEVTGGIDQFEPLTIVNVSPTGLAKRGGMRVGDEITQINDVPALEMTFNEALQMFRKNSRYVR 107

  Fly   149 LKVRGVGMLPVRDLPEER--------------------LSWS---------VVKLPSVSGTPSES 184
            :.|||..     |.|.|.                    :.|:         |.|..:....||:.
  Fly   108 VYVRGDD-----DAPGEEDWTCDCWFKPRKPWRRDFTPIQWTFPWNDRRKPVYKESNCFMVPSKM 167

  Fly   185 SFK-GERRGASRDISVVLHVAPRTKLGLGICKGPEWKPGIFVQFTKDRSVAREAGLRPGD 243
            ..| ..||.|:..:.....:||.|: .|.....|:.:||..:..|    |.|..|..|.|
  Fly   168 EEKIRARRAATSAVHKKDELAPHTR-SLTPTPRPKNQPGPNLLET----VLRPRGPPPRD 222

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5921NP_727061.2 PDZ_signaling 82..152 CDD:238492 18/67 (27%)
PDZ_signaling 197..276 CDD:238492 13/47 (28%)
CG15617NP_611151.1 PDZ_signaling 30..111 CDD:238492 18/67 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3528
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.