DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5921 and Lnx2

DIOPT Version :9

Sequence 1:NP_727061.2 Gene:CG5921 / 31538 FlyBaseID:FBgn0029835 Length:886 Species:Drosophila melanogaster
Sequence 2:NP_001101799.1 Gene:Lnx2 / 360761 RGDID:1308222 Length:686 Species:Rattus norvegicus


Alignment Length:302 Identity:66/302 - (21%)
Similarity:116/302 - (38%) Gaps:68/302 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    98 GFFVSHVEHGGEAHLKG-LRIGDQILRINGFRLDD-----AVHKEFIQLVAGQDRVTLKVRGVGM 156
            |.|:..:..||.|...| |...|::|.|||..|..     |.|  .||  |..:||.|.:    .
  Rat   362 GVFILDLLEGGLAAQDGRLSSNDRVLAINGHDLKQGTPELAAH--IIQ--ASGERVNLTI----A 418

  Fly   157 LPVRDLPEERLSWSVVKLPSVSGTPSESSFKGERRGASRDIS---------VVLHVAPRTKLGLG 212
            .|.:..|......:.....:.:..||.|     |..:.:|::         :.:...|...||:.
  Rat   419 RPGKPQPSNGSREAGAHSSNHAQPPSHS-----RPSSHKDLTRCVTCQEKHITVKKEPHESLGMT 478

  Fly   213 ICKGPEWKPG---IFVQFTKDRS-VAREAGLRPGDQILSVNSIDFSDVLFSEAVAVMKSSSKLDM 273
            :..|...|.|   |||....... :||:..::.||.:|::|.||.:::..|||||::|:|:....
  Rat   479 VAGGRGSKSGELPIFVTSVPPHGCLARDGRIKRGDVLLNINGIDLTNLSHSEAVAMLKASAASPA 543

  Fly   274 VVRTAAGCDLFPGESSGYNSSASSVTGDQSPCWADAKSKRLTAVREESGAGGGGCGLSSAPGAGS 338
            |:..|....:        ...|:..|.:|...:::                      :....:.|
  Rat   544 VILKALEVQI--------AEEAAQATEEQPGAFSE----------------------NEYDASWS 578

  Fly   339 PNWSQGVEVHKQMNKTIIKLTENGTSINNTYIASTGGSSVSG 380
            |:|...:.:...::..      :...:..:|:.|.|.|.|.|
  Rat   579 PSWVMWLGLPSALHSC------HDIVLRRSYLGSWGFSIVGG 614

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5921NP_727061.2 PDZ_signaling 82..152 CDD:238492 21/59 (36%)
PDZ_signaling 197..276 CDD:238492 25/91 (27%)
Lnx2NP_001101799.1 mRING-HC-C3HC3D_LNX2 46..90 CDD:319694
PDZ 229..315 CDD:214570
PDZ 335..421 CDD:214570 21/66 (32%)
PDZ_signaling 462..538 CDD:238492 23/75 (31%)
PDZ_signaling 595..679 CDD:238492 6/20 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3528
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.