DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5921 and Stxbp4

DIOPT Version :9

Sequence 1:NP_727061.2 Gene:CG5921 / 31538 FlyBaseID:FBgn0029835 Length:886 Species:Drosophila melanogaster
Sequence 2:XP_006247190.1 Gene:Stxbp4 / 303443 RGDID:1307903 Length:557 Species:Rattus norvegicus


Alignment Length:248 Identity:63/248 - (25%)
Similarity:87/248 - (35%) Gaps:68/248 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   179 GTPS-ESSFKGERRGASRDISVVLHVAPRTKLGLGICKGPEWKPGIFV---QFTKDRSVAREAGL 239
            ||.| .||...||..|.|    |:.||..|.|||.|..|.:...|..|   :.|......::..|
  Rat     4 GTSSARSSSPLERDPAFR----VITVAKETGLGLKILGGIDRNEGPLVYIHEVTPGGDCYKDGRL 64

  Fly   240 RPGDQILSVNSIDFSDVLFSEAV-----AVMKSSSKLDMV-VRTAAGCDLFPG------------ 286
            :||||::|:|......|.|.||.     |.::..|.|::. :|..:.|. .||            
  Rat    65 KPGDQLVSINKESMIGVSFEEAKNILTRAKLRWESPLEIAFIRQKSYCG-HPGNICCQSPPVSED 128

  Fly   287 ---ESSGYNSSASSVTG------DQSPCWADAKSKRLTAVR---EESGAGGGGCGLSSAPGAGSP 339
               ::|.:| ..||..|      ..:|...|:.....|.::   |.|.|     ||:..|     
  Rat   129 CEPQTSAFN-LLSSPAGTLLPKTSSTPRTQDSILPSCTVIQTQPEHSQA-----GLAPVP----- 182

  Fly   340 NWSQGVEVHKQMNKTIIKLTENGTSINNTYIASTGGSSVSG-SGSTGSGTSGR 391
                             .|....|..:|..||.......|| .|......|.|
  Rat   183 -----------------SLNNRPTDTSNADIAPAWTDDASGPQGKISLNPSAR 218

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5921NP_727061.2 PDZ_signaling 82..152 CDD:238492
PDZ_signaling 197..276 CDD:238492 26/87 (30%)
Stxbp4XP_006247190.1 PDZ_signaling 21..94 CDD:238492 24/76 (32%)
TPR_MLP1_2 299..400 CDD:285204
GBP_C <306..389 CDD:303769
coiled coil 359..369 CDD:293879
coiled coil 378..389 CDD:293879
WW 502..531 CDD:278809
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3528
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.