DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MCTS1 and TMA20

DIOPT Version :9

Sequence 1:NP_001245541.1 Gene:MCTS1 / 31536 FlyBaseID:FBgn0029833 Length:182 Species:Drosophila melanogaster
Sequence 2:NP_010923.3 Gene:TMA20 / 856725 SGDID:S000002957 Length:181 Species:Saccharomyces cerevisiae


Alignment Length:179 Identity:89/179 - (49%)
Similarity:123/179 - (68%) Gaps:6/179 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MFKKFEEKDSISSIQQLKSSVQKGIRAKLLEAYPKLESHIDLILPKKDSYRIAKCHDHIELLLNG 65
            |||||..:| :.|..::|||:|:.::|||::.|||:|..||.::|||....:.||.|.|: |.:.
Yeast     1 MFKKFTRED-VHSRSKVKSSIQRTLKAKLVKQYPKIEDVIDELIPKKSQIELIKCEDKIQ-LYSV 63

  Fly    66 AGDQVFFRHRDGPWMPTLRLLHKFPYFVTMQQVDKGAIRFVLSGANVMCPGLTSPGACMTPA--- 127
            .|:.:||:..| ..:|:|:|:||||......|||:|||:|||||||:|||||||.||.:.||   
Yeast    64 DGEVLFFQKFD-ELIPSLKLVHKFPEAYPTVQVDRGAIKFVLSGANIMCPGLTSAGADLPPAPGY 127

  Fly   128 DKDTVVAIMAEGKEHALAVGLLTLSTQEILAKNKGIGIETYHFLNDGLW 176
            :|.|:|.|.||.||:|||:|.|.:.|:||.:.|||..||..|.|.|.||
Yeast   128 EKGTIVVINAENKENALAIGELMMGTEEIKSVNKGHSIELIHHLGDPLW 176

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MCTS1NP_001245541.1 MCT1_N 4..81 CDD:211422 29/76 (38%)
Tma20 18..177 CDD:224927 82/162 (51%)
PUA 69..173 CDD:294405 57/106 (54%)
TMA20NP_010923.3 Tma20 12..181 CDD:224927 83/167 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157344853
Domainoid 1 1.000 90 1.000 Domainoid score I1777
eggNOG 1 0.900 - - E1_COG2016
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H5803
Inparanoid 1 1.050 163 1.000 Inparanoid score I1047
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54154
OrthoFinder 1 1.000 - - FOG0003649
OrthoInspector 1 1.000 - - oto99939
orthoMCL 1 0.900 - - OOG6_101211
Panther 1 1.100 - - LDO PTHR22798
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1530
SonicParanoid 1 1.000 - - X2520
TreeFam 1 0.960 - -
1514.790

Return to query results.
Submit another query.