DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MCTS1 and TMA64

DIOPT Version :9

Sequence 1:NP_001245541.1 Gene:MCTS1 / 31536 FlyBaseID:FBgn0029833 Length:182 Species:Drosophila melanogaster
Sequence 2:NP_010402.3 Gene:TMA64 / 851695 SGDID:S000002524 Length:565 Species:Saccharomyces cerevisiae


Alignment Length:196 Identity:46/196 - (23%)
Similarity:85/196 - (43%) Gaps:40/196 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MFKKFEEKDSISSIQQLKSSVQKGIRAKLLEAYPKLESHIDLILPKKDSYRIAKCHDHIELLLNG 65
            ||||   :..|.::..||:|.:|    |||:.:.|..::      ::.|:|.:...   :...||
Yeast     1 MFKK---EPHIKALSNLKNSERK----KLLQTFQKQTNN------EEYSFRTSTIK---QTNFNG 49

  Fly    66 A-----------GDQVFF--RHRDGPWMPTLRLLHKFPYFVTMQQVDKGAI-RFVLSGANVMCPG 116
            .           ...:.|  :|:: ...||:....::|..:.:.......| ..:.:|||:|..|
Yeast    50 QKSVGTVYTDENNTPILFKEKHKE-QLFPTVYSCWEYPALLPIVLTHGFVIEEHLFNGANLMISG 113

  Fly   117 LTSPGACMTPADK-DTVVAIMA-EGKEHALAVGLLTL---STQEILAKNKGIGIETYHFLNDGLW 176
            ...|   ..|..| .|:..|.: :..|..||:|::.|   |..:::.:. |:.::..|..||||.
Yeast   114 SIPP---FDPRCKIGTLCGIASKQAPETVLAIGIVELDLPSFDKVIGET-GVAVKIIHHFNDGLS 174

  Fly   177 K 177
            |
Yeast   175 K 175

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MCTS1NP_001245541.1 MCT1_N 4..81 CDD:211422 16/89 (18%)
Tma20 18..177 CDD:224927 39/177 (22%)
PUA 69..173 CDD:294405 24/111 (22%)
TMA64NP_010402.3 Pre-PUA 2..86 CDD:407697 20/100 (20%)
PUA_eIF2d-like 88..170 CDD:409298 19/85 (22%)
eIF2D_C 474..556 CDD:211321
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2016
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.