Sequence 1: | NP_001245541.1 | Gene: | MCTS1 / 31536 | FlyBaseID: | FBgn0029833 | Length: | 182 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_010402.3 | Gene: | TMA64 / 851695 | SGDID: | S000002524 | Length: | 565 | Species: | Saccharomyces cerevisiae |
Alignment Length: | 196 | Identity: | 46/196 - (23%) |
---|---|---|---|
Similarity: | 85/196 - (43%) | Gaps: | 40/196 - (20%) |
- Green bases have known domain annotations that are detailed below.
Fly 1 MFKKFEEKDSISSIQQLKSSVQKGIRAKLLEAYPKLESHIDLILPKKDSYRIAKCHDHIELLLNG 65
Fly 66 A-----------GDQVFF--RHRDGPWMPTLRLLHKFPYFVTMQQVDKGAI-RFVLSGANVMCPG 116
Fly 117 LTSPGACMTPADK-DTVVAIMA-EGKEHALAVGLLTL---STQEILAKNKGIGIETYHFLNDGLW 176
Fly 177 K 177 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
MCTS1 | NP_001245541.1 | MCT1_N | 4..81 | CDD:211422 | 16/89 (18%) |
Tma20 | 18..177 | CDD:224927 | 39/177 (22%) | ||
PUA | 69..173 | CDD:294405 | 24/111 (22%) | ||
TMA64 | NP_010402.3 | Pre-PUA | 2..86 | CDD:407697 | 20/100 (20%) |
PUA_eIF2d-like | 88..170 | CDD:409298 | 19/85 (22%) | ||
eIF2D_C | 474..556 | CDD:211321 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG2016 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |