DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MCTS1 and AT1G09150

DIOPT Version :9

Sequence 1:NP_001245541.1 Gene:MCTS1 / 31536 FlyBaseID:FBgn0029833 Length:182 Species:Drosophila melanogaster
Sequence 2:NP_172387.1 Gene:AT1G09150 / 837434 AraportID:AT1G09150 Length:181 Species:Arabidopsis thaliana


Alignment Length:181 Identity:95/181 - (52%)
Similarity:128/181 - (70%) Gaps:9/181 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MFKKF--EEKDSISSIQQLKSSVQKGIRAKLLEAYPKLESHIDLILPKKDSYRIAKCHDHIEL-L 62
            |||||  ||   |||..|:|:|||:.||..:.:.||.|||.::.:||||....:.||.:|:.| :
plant     1 MFKKFCLEE---ISSQNQVKASVQRRIRQSIQDEYPGLESVMEDLLPKKIPLIVVKCPNHLTLVV 62

  Fly    63 LNGAGDQVFFRHRDGPWMPTLRLLHKFPYFVTMQQVDKGAIRFVLSGANVMCPGLTSPGACM-TP 126
            :|..  .:||..||||:||||||||::|..:...|||:|||:|||||||:|||||||||..: ..
plant    63 VNNV--PLFFCIRDGPYMPTLRLLHQYPNIMKRFQVDRGAIKFVLSGANIMCPGLTSPGGVLDQE 125

  Fly   127 ADKDTVVAIMAEGKEHALAVGLLTLSTQEILAKNKGIGIETYHFLNDGLWK 177
            .:.:..|||.||||:||||:|...:|.::|.:.|||||::..|:|||||||
plant   126 VEAERPVAIYAEGKQHALAIGFTKMSAKDIKSINKGIGVDNMHYLNDGLWK 176

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MCTS1NP_001245541.1 MCT1_N 4..81 CDD:211422 34/79 (43%)
Tma20 18..177 CDD:224927 82/160 (51%)
PUA 69..173 CDD:294405 58/104 (56%)
AT1G09150NP_172387.1 MCT1_N 3..79 CDD:211422 35/80 (44%)
PUA_MCTS-1-like 79..175 CDD:409297 54/95 (57%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 91 1.000 Domainoid score I2648
eggNOG 1 0.900 - - E1_COG2016
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 176 1.000 Inparanoid score I1491
OMA 1 1.010 - - QHG54154
OrthoDB 1 1.010 - - D1257440at2759
OrthoFinder 1 1.000 - - FOG0003649
OrthoInspector 1 1.000 - - oto3647
orthoMCL 1 0.900 - - OOG6_101211
Panther 1 1.100 - - LDO PTHR22798
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X2520
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1413.840

Return to query results.
Submit another query.