DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MCTS1 and Mcts2

DIOPT Version :9

Sequence 1:NP_001245541.1 Gene:MCTS1 / 31536 FlyBaseID:FBgn0029833 Length:182 Species:Drosophila melanogaster
Sequence 2:NP_079819.1 Gene:Mcts2 / 66405 MGIID:1913655 Length:181 Species:Mus musculus


Alignment Length:183 Identity:107/183 - (58%)
Similarity:143/183 - (78%) Gaps:3/183 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MFKKFEEKDSISSIQQLKSSVQKGIRAKLLEAYPKLESHIDLILPKKDSYRIAKCHDHIELL-LN 64
            |||||:||:|:|:..|||:||.|||:::|.|.:|.:|..::.|:||||..:|.:||:|:|:| :|
Mouse     1 MFKKFDEKESVSNCIQLKTSVIKGIKSQLTEQFPGIEPWLNQIMPKKDPVKIVRCHEHMEILTVN 65

  Fly    65 GAGDQVFFRHRDGPWMPTLRLLHKFPYFVTMQQVDKGAIRFVLSGANVMCPGLTSPGACMTPADK 129
              |:.:|||.|.||:.||||||||:|:.:..||||||||:|||||||:||||||||||.:..|..
Mouse    66 --GELLFFRQRKGPFYPTLRLLHKYPFILPHQQVDKGAIKFVLSGANIMCPGLTSPGAKLYTAAV 128

  Fly   130 DTVVAIMAEGKEHALAVGLLTLSTQEILAKNKGIGIETYHFLNDGLWKSKPVK 182
            ||:||:|||||||||.||::.::..:|...|||||||..|:||||||..|..|
Mouse   129 DTIVAVMAEGKEHALCVGVMKMAAADIEKINKGIGIENIHYLNDGLWHMKTYK 181

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MCTS1NP_001245541.1 MCT1_N 4..81 CDD:211422 37/77 (48%)
Tma20 18..177 CDD:224927 93/159 (58%)
PUA 69..173 CDD:294405 66/103 (64%)
Mcts2NP_079819.1 MCT1_N 4..80 CDD:211422 37/77 (48%)
PUA_MCTS-1-like 80..175 CDD:409297 63/94 (67%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167842751
Domainoid 1 1.000 110 1.000 Domainoid score I6315
eggNOG 1 0.900 - - E1_COG2016
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 229 1.000 Inparanoid score I3445
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54154
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003649
OrthoInspector 1 1.000 - - otm43792
orthoMCL 1 0.900 - - OOG6_101211
Panther 1 1.100 - - O PTHR22798
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X2520
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1413.760

Return to query results.
Submit another query.