DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MCTS1 and eif2d

DIOPT Version :9

Sequence 1:NP_001245541.1 Gene:MCTS1 / 31536 FlyBaseID:FBgn0029833 Length:182 Species:Drosophila melanogaster
Sequence 2:NP_989398.1 Gene:eif2d / 395035 XenbaseID:XB-GENE-947279 Length:588 Species:Xenopus tropicalis


Alignment Length:192 Identity:55/192 - (28%)
Similarity:87/192 - (45%) Gaps:31/192 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MF-KKFEEKDSISSIQQLKSSVQKGIRAKLLEAYPKLES-HIDLILPKKDSYRIAKCHDHIELLL 63
            || |.|..|.:.:    :|.|.::.:||.:..|:|.|.: ::..::|.|:...|.|...|     
 Frog     1 MFAKNFRVKSNTA----IKGSDRRKLRADISSAFPFLTTENLSELMPSKEELSIVKVFAH----- 56

  Fly    64 NGAGDQV-FFRHRDGPWM--------PTLRLLHKF----PYFVTMQQVDKGAIRFVLSGANVMCP 115
              .||.| .:.|...|.|        ||:..|.|:    |.|.|...|    :..:..||::|.|
 Frog    57 --KGDAVTLYVHNRNPVMFELEKNLYPTVYALWKYPDLLPAFTTWPPV----LEKMAGGADLMLP 115

  Fly   116 GLTSPGACMTPADKDTVVAIMAEGKEHALAVGLLTLSTQEILAKN-KGIGIETYHFLNDGLW 176
            |:..|...:....:.::.||...|....:|||:.|:|::|:||.. ||.|....|...|.||
 Frog   116 GVVVPSFGLPEIQQGSLCAITLVGNRAPVAVGVATMSSKEMLASGMKGKGFNILHTFGDQLW 177

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MCTS1NP_001245541.1 MCT1_N 4..81 CDD:211422 20/86 (23%)
Tma20 18..177 CDD:224927 50/174 (29%)
PUA 69..173 CDD:294405 33/117 (28%)
eif2dNP_989398.1 Pre-PUA 2..90 CDD:375366 26/98 (27%)
Tma20 7..177 CDD:224927 49/184 (27%)
eIF2D_C 495..579 CDD:211321
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.