| Sequence 1: | NP_001245541.1 | Gene: | MCTS1 / 31536 | FlyBaseID: | FBgn0029833 | Length: | 182 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_957456.1 | Gene: | eif2d / 394137 | ZFINID: | ZDB-GENE-040426-1226 | Length: | 590 | Species: | Danio rerio |
| Alignment Length: | 207 | Identity: | 47/207 - (22%) |
|---|---|---|---|
| Similarity: | 82/207 - (39%) | Gaps: | 54/207 - (26%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 5 FEEKDSISSIQQLKSSVQKGIRAKLLEAYPKLE-SHIDLILPKKDSYRIAKCHDHIELLLNGAGD 68
Fly 69 QVFFRHRDGPWMPTLRLLHKFPYFVTMQQVDK-----------------------GAIRFVLSGA 110
Fly 111 NVMCPGLTSPGACMTPADKDTVVAIMAEGKEHALAVGLLTLSTQEILAKN---KGIGIETYHFLN 172
Fly 173 DGLW----KSKP 180 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| MCTS1 | NP_001245541.1 | MCT1_N | 4..81 | CDD:211422 | 17/76 (22%) |
| Tma20 | 18..177 | CDD:224927 | 43/189 (23%) | ||
| PUA | 69..173 | CDD:294405 | 26/129 (20%) | ||
| eif2d | NP_957456.1 | eIF2D_N | 6..81 | CDD:211423 | 25/95 (26%) |
| Tma20 | 19..179 | CDD:224927 | 41/182 (23%) | ||
| PUA | 64..170 | CDD:294405 | 22/110 (20%) | ||
| eIF2D_C | 496..580 | CDD:211321 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 1 | 0.900 | - | - | E1_COG2016 | |
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| ZFIN | 0 | 0.000 | Not matched by this tool. | |||
| 2 | 1.810 | |||||