DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MCTS1 and mcts1

DIOPT Version :9

Sequence 1:NP_001245541.1 Gene:MCTS1 / 31536 FlyBaseID:FBgn0029833 Length:182 Species:Drosophila melanogaster
Sequence 2:NP_957365.1 Gene:mcts1 / 394046 ZFINID:ZDB-GENE-040426-957 Length:181 Species:Danio rerio


Alignment Length:183 Identity:108/183 - (59%)
Similarity:145/183 - (79%) Gaps:3/183 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MFKKFEEKDSISSIQQLKSSVQKGIRAKLLEAYPKLESHIDLILPKKDSYRIAKCHDHIELL-LN 64
            |||||:||:::|:..|||:||.|||:.:||:.:|.::..::.|:||||..:|.:||:|||:| :|
Zfish     1 MFKKFDEKENVSNCIQLKTSVIKGIKNQLLDQFPNIDDWLNQIMPKKDPVKIVRCHEHIEILTVN 65

  Fly    65 GAGDQVFFRHRDGPWMPTLRLLHKFPYFVTMQQVDKGAIRFVLSGANVMCPGLTSPGACMTPADK 129
              |:.:|||.|:||:.||||||||:|:.:..||||||||:|||||||:||||||||||.:.||:.
Zfish    66 --GELLFFRQREGPFYPTLRLLHKYPFILPHQQVDKGAIKFVLSGANIMCPGLTSPGAKLYPAES 128

  Fly   130 DTVVAIMAEGKEHALAVGLLTLSTQEILAKNKGIGIETYHFLNDGLWKSKPVK 182
            |||||||||||:|||.||::.:|..:|...|.|||||..|:||||||..|..|
Zfish   129 DTVVAIMAEGKQHALCVGVMKMSADDIEKVNMGIGIENVHYLNDGLWHMKTYK 181

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MCTS1NP_001245541.1 MCT1_N 4..81 CDD:211422 36/77 (47%)
Tma20 18..177 CDD:224927 95/159 (60%)
PUA 69..173 CDD:294405 68/103 (66%)
mcts1NP_957365.1 MCT1_N 4..80 CDD:211422 36/77 (47%)
Tma20 23..177 CDD:224927 93/155 (60%)
PUA 64..172 CDD:294405 70/109 (64%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170587187
Domainoid 1 1.000 109 1.000 Domainoid score I6328
eggNOG 1 0.900 - - E1_COG2016
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H5803
Inparanoid 1 1.050 227 1.000 Inparanoid score I3461
OMA 1 1.010 - - QHG54154
OrthoDB 1 1.010 - - D1257440at2759
OrthoFinder 1 1.000 - - FOG0003649
OrthoInspector 1 1.000 - - oto41630
orthoMCL 1 0.900 - - OOG6_101211
Panther 1 1.100 - - LDO PTHR22798
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X2520
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1514.770

Return to query results.
Submit another query.